BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001382-TA|BGIBMGA001382-PA|IPR002100|Transcription factor, MADS-box (137 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 27 0.095 X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. 23 0.89 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 26.6 bits (56), Expect = 0.095 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 80 PDIADD-GYASLQPKKSPPSNGKKTKGRVKIKMEYIDNKLRRYTTFSKRK 128 PD+ D+ GY + +K PP G +IK + +R ++T+ R+ Sbjct: 1637 PDLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGTVIRSIRSHSTWDPRR 1686 >X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. Length = 103 Score = 23.4 bits (48), Expect = 0.89 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 101 KKTKGRVKIKMEYIDNKLRRYTTFSKRKT 129 ++T+G +K+ +E + YT +KRKT Sbjct: 53 EETRGVLKVFLENVIRDAVTYTEHTKRKT 81 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.315 0.136 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,946 Number of Sequences: 429 Number of extensions: 2513 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 137 length of database: 140,377 effective HSP length: 52 effective length of query: 85 effective length of database: 118,069 effective search space: 10035865 effective search space used: 10035865 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -