BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001380-TA|BGIBMGA001380-PA|IPR000357|HEAT (1377 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 25 3.2 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 25 4.3 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 25.4 bits (53), Expect = 3.2 Identities = 9/24 (37%), Positives = 16/24 (66%) Query: 393 TARNHGRRAYWSYQRLFPAEAELL 416 T RN+GRR +Y L+P+ +++ Sbjct: 207 TLRNYGRRINCTYVALYPSSVQVI 230 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 25.0 bits (52), Expect = 4.3 Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 1261 YMFWKLRVHQQAARG-VHPTTTRQQRDNDVAEDAAHSHARHADVTRARRPVLPSL 1314 Y+ + R+ ++A + ++ + + R+ D AE++ S H + + R PSL Sbjct: 220 YLATRRRLRERARQSRINAVQSTRHREADDAEESVSSETNHNERSTPRSHAKPSL 274 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.132 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 315,274 Number of Sequences: 429 Number of extensions: 11511 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 24 Number of HSP's gapped (non-prelim): 2 length of query: 1377 length of database: 140,377 effective HSP length: 66 effective length of query: 1311 effective length of database: 112,063 effective search space: 146914593 effective search space used: 146914593 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -