BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001379-TA|BGIBMGA001379-PA|IPR002659|Glycosyl transferase, family 31 (557 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 23 5.6 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 23 5.6 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 23.0 bits (47), Expect = 5.6 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 6/57 (10%) Query: 60 KFFLFSSAVILFCVLMYIPVYNKA--NNQISKAIVSGWSVHSNRDTKLYVRPQNVTV 114 K F +A+I+ + ++ ++ ++Q+++ + S SNR T L ++PQN ++ Sbjct: 261 KQFYIHNALIVRALFLFFQLWATVYTSSQVTREVQS----RSNRMTPLKLQPQNFSI 313 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 23.0 bits (47), Expect = 5.6 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 6/57 (10%) Query: 60 KFFLFSSAVILFCVLMYIPVYNKA--NNQISKAIVSGWSVHSNRDTKLYVRPQNVTV 114 K F +A+I+ + ++ ++ ++Q+++ + S SNR T L ++PQN ++ Sbjct: 257 KQFYIHNALIVRALFLFFQLWATVYTSSQVTREVQS----RSNRMTPLKLQPQNFSI 309 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,552 Number of Sequences: 317 Number of extensions: 5451 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 2 length of query: 557 length of database: 114,650 effective HSP length: 60 effective length of query: 497 effective length of database: 95,630 effective search space: 47528110 effective search space used: 47528110 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -