GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001379-TA|BGIBMGA001379-PA|IPR002659|Glycosyl
transferase, family 31
         (557 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p...    26   3.0  

>AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal
           ion/proton exchanger 3 protein.
          Length = 1221

 Score = 25.8 bits (54), Expect = 3.0
 Identities = 11/40 (27%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query: 1   MEYSPSHKNWHDEERYHVHSDESPVLSYRHEKYKNYTQYS 40
           ++Y+PS K+  D + +H+ S+E  +  YR  +  +Y++++
Sbjct: 783 LDYNPSKKDLTDAKIHHLLSEE--LKPYRRHRRLSYSRHA 820


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.319    0.136    0.406 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 578,058
Number of Sequences: 2123
Number of extensions: 23318
Number of successful extensions: 112
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 112
Number of HSP's gapped (non-prelim): 1
length of query: 557
length of database: 516,269
effective HSP length: 67
effective length of query: 490
effective length of database: 374,028
effective search space: 183273720
effective search space used: 183273720
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 50 (24.2 bits)