BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001378-TA|BGIBMGA001378-PA|undefined (130 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 1.4 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 1.4 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 1.4 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 1.4 Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 21 VTEKPLYIEDNTNGYYSDASNSVIRRVNVPKEPSPTY 57 V + +Y+ N S+A +VI +V +EP Y Sbjct: 85 VDPEDMYLAVKDNKLASNAGYNVIEQVRTKEEPHAPY 121 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 1.4 Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 21 VTEKPLYIEDNTNGYYSDASNSVIRRVNVPKEPSPTY 57 V + +Y+ N S+A +VI +V +EP Y Sbjct: 85 VDPEDMYLAVKDNKLASNAGYNVIEQVRTKEEPHAPY 121 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 1.4 Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 21 VTEKPLYIEDNTNGYYSDASNSVIRRVNVPKEPSPTY 57 V + +Y+ N S+A +VI +V +EP Y Sbjct: 85 VDPEDMYLAVKDNKLASNAGYNVIEQVRTKEEPHAPY 121 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.309 0.126 0.347 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,003 Number of Sequences: 429 Number of extensions: 1480 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 130 length of database: 140,377 effective HSP length: 51 effective length of query: 79 effective length of database: 118,498 effective search space: 9361342 effective search space used: 9361342 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (20.8 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -