GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001376-TA|BGIBMGA001376-PA|undefined
         (119 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY028785-1|AAK32959.1|  509|Anopheles gambiae cytochrome P450 pr...    25   0.71 

>AY028785-1|AAK32959.1|  509|Anopheles gambiae cytochrome P450
           protein.
          Length = 509

 Score = 25.0 bits (52), Expect = 0.71
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 10  CYECDSWSDPRCKDPFNYTALPRDQPPLQTCNGCCVKMVRYSKSPYEVVR 59
           C++ D +S   C++   YT LP  + P + C G    M++       +VR
Sbjct: 425 CFDPDRFSAEACRNRTPYTFLPFGEGP-RVCIGMRFGMMQVKVGLVSMVR 473


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.328    0.136    0.487 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 132,320
Number of Sequences: 2123
Number of extensions: 4569
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 119
length of database: 516,269
effective HSP length: 57
effective length of query: 62
effective length of database: 395,258
effective search space: 24505996
effective search space used: 24505996
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.8 bits)
S2: 43 (21.4 bits)