BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001374-TA|BGIBMGA001374-PA|undefined (295 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 24 1.2 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 2.7 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 22 4.7 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 22 4.7 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 22 4.7 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/17 (52%), Positives = 12/17 (70%) Query: 270 EKYTSYFSNNVKNLSNF 286 +KYT+YF N +L NF Sbjct: 344 DKYTTYFLNTYPHLFNF 360 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 105 ARLRCVVEVNGERIVQTRGQPGELFPDKYMSS 136 AR +G + VQT +PG+ P+K S+ Sbjct: 413 ARPPSTPSADGSKPVQTTPKPGQWVPEKSTST 444 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 250 RTNREHNYQSHPVKINGYTPEKY 272 RT+R+H Q + + N Y E Y Sbjct: 295 RTDRKHTQQHYQMNQNMYPGEMY 317 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 250 RTNREHNYQSHPVKINGYTPEKY 272 RT+R+H Q + + N Y E Y Sbjct: 243 RTDRKHTQQHYQMNQNMYPGEMY 265 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 250 RTNREHNYQSHPVKINGYTPEKY 272 RT+R+H Q + + N Y E Y Sbjct: 426 RTDRKHTQQHYQMNQNMYPGEMY 448 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.135 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,410 Number of Sequences: 317 Number of extensions: 3365 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 7 length of query: 295 length of database: 114,650 effective HSP length: 56 effective length of query: 239 effective length of database: 96,898 effective search space: 23158622 effective search space used: 23158622 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -