BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001372-TA|BGIBMGA001372-PA|IPR002558|I/LWEQ, IPR011000|Apolipophorin III-like, IPR009072|Histone-fold (1856 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 24 8.5 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 24.2 bits (50), Expect = 8.5 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 1308 EQLRMLDEIHNNRFREVEDVQEKKDESVMVTNVTSLLKTVKAVEDEH 1354 + LR LD+I N FR V + ++ E + NV +L+ K V D + Sbjct: 205 DTLRNLDKIVTNGFRNVAESRKIFIECIEQYNV--ILRYTKIVSDTY 249 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.129 0.360 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 312,359 Number of Sequences: 317 Number of extensions: 11056 Number of successful extensions: 39 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 39 Number of HSP's gapped (non-prelim): 1 length of query: 1856 length of database: 114,650 effective HSP length: 67 effective length of query: 1789 effective length of database: 93,411 effective search space: 167112279 effective search space used: 167112279 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -