GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001372-TA|BGIBMGA001372-PA|IPR002558|I/LWEQ,
IPR011000|Apolipophorin III-like, IPR009072|Histone-fold
         (1856 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory recept...    24   8.5  

>AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory receptor
            candidate 27 protein.
          Length = 346

 Score = 24.2 bits (50), Expect = 8.5
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 1308 EQLRMLDEIHNNRFREVEDVQEKKDESVMVTNVTSLLKTVKAVEDEH 1354
            + LR LD+I  N FR V + ++   E +   NV  +L+  K V D +
Sbjct: 205  DTLRNLDKIVTNGFRNVAESRKIFIECIEQYNV--ILRYTKIVSDTY 249


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.314    0.129    0.360 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 312,359
Number of Sequences: 317
Number of extensions: 11056
Number of successful extensions: 39
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 39
Number of HSP's gapped (non-prelim): 1
length of query: 1856
length of database: 114,650
effective HSP length: 67
effective length of query: 1789
effective length of database: 93,411
effective search space: 167112279
effective search space used: 167112279
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 50 (24.2 bits)