BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001371-TA|BGIBMGA001371-PA|IPR002558|I/LWEQ (697 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 24 3.1 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 5.3 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 23 7.1 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 23 7.1 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 24.2 bits (50), Expect = 3.1 Identities = 13/43 (30%), Positives = 21/43 (48%) Query: 565 SFGQAFNNLLGVGMEMAGQTEDRETQSLMVNSMKSVTVNSSKL 607 S AFN+L V +E+AG +L N + +V + + L Sbjct: 470 SLSLAFNSLPTVALEVAGNISSLRYLNLDYNDLSAVPIVTHSL 512 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 23.4 bits (48), Expect = 5.3 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Query: 268 TQLITSA----QNATQYNTNRYSQETLLEECKVLNEHLPRMVEAVNVSNVKP 315 T L+TSA QN + T + L E ++ NE R+VE + KP Sbjct: 113 TGLLTSAGPKWQNRRKILTPAFHFNILQEFIQIFNEETKRLVEDLEAECHKP 164 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 23.0 bits (47), Expect = 7.1 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Query: 329 EAFLQPSGHVISAARGALP 347 EAF QP GH+++ A A+P Sbjct: 165 EAF-QPKGHLLTIAVSAIP 182 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 23.0 bits (47), Expect = 7.1 Identities = 12/41 (29%), Positives = 19/41 (46%) Query: 275 QNATQYNTNRYSQETLLEECKVLNEHLPRMVEAVNVSNVKP 315 QN + T + L E ++ NE R+VE + + KP Sbjct: 124 QNRRKILTPAFHFNILQEFIQIFNEETKRLVEDLEAESHKP 164 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.312 0.123 0.331 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,539 Number of Sequences: 317 Number of extensions: 3158 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 4 length of query: 697 length of database: 114,650 effective HSP length: 62 effective length of query: 635 effective length of database: 94,996 effective search space: 60322460 effective search space used: 60322460 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -