BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001367-TA|BGIBMGA001367-PA|IPR001395|Aldo/keto reductase (331 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 22 7.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 7.2 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.5 AF260822-1|AAG02020.1| 138|Tribolium castaneum alpha-esterase l... 21 9.5 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 21.8 bits (44), Expect = 7.2 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 88 IKKKIAEGVVKREDLFVTT-KLWNTNHKKEAVLPALRKSLKNLDLDY 133 ++ KI E + DL V ++ H A L A+ SLKNL+ D+ Sbjct: 181 VRSKIIEYMNHLVDLGVAGFRVDAAKHMWPADLEAIYASLKNLNTDH 227 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 7.2 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Query: 198 VLQVEINLNLQQPALLDY-CKAQGIVVVAYTPFGNLFNRQPSAPAPRADDQRL 249 ++QV +L Q LL+Y K +G VV Y + + P DQRL Sbjct: 614 IIQVANSLR-QYEDLLEYEAKEEGPKVVCYMTNWAFYRKAEGKFVPEHIDQRL 665 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/41 (24%), Positives = 18/41 (43%) Query: 100 EDLFVTTKLWNTNHKKEAVLPALRKSLKNLDLDYVDLYLIH 140 ED F +LW + K+ +L + ++K V + H Sbjct: 125 EDTFYDIRLWGVSFSKKQILRSDDLAVKTTSKSLVPTPVTH 165 >AF260822-1|AAG02020.1| 138|Tribolium castaneum alpha-esterase like protein E3 protein. Length = 138 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Query: 308 DNGYRTLSP-LFWAHSPYFPFESKN 331 D + +L P L W H YF F S N Sbjct: 66 DGIHTSLYPVLVWIHGGYFIFGSGN 90 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,150 Number of Sequences: 317 Number of extensions: 3378 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 5 length of query: 331 length of database: 114,650 effective HSP length: 57 effective length of query: 274 effective length of database: 96,581 effective search space: 26463194 effective search space used: 26463194 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -