SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001366-TA|BGIBMGA001366-PA|undefined
         (242 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly pro...    24   1.5  

>AY313893-1|AAQ82184.1|  437|Apis mellifera major royal jelly
           protein MRJP6 protein.
          Length = 437

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 4/34 (11%)

Query: 48  WEKIAQSLNKVDEKVYKTGCKWSRY----WADWK 77
           ++ +  SLN + EK+   GC    Y    WA++K
Sbjct: 87  YDGVPSSLNVISEKIGNGGCLLQPYPDWSWANYK 120


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.134    0.392 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 63,397
Number of Sequences: 429
Number of extensions: 2378
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 242
length of database: 140,377
effective HSP length: 56
effective length of query: 186
effective length of database: 116,353
effective search space: 21641658
effective search space used: 21641658
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 43 (21.4 bits)

- SilkBase 1999-2023 -