Silkworm BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001364-TA|BGIBMGA001364-PA|IPR007234|Vps53-like,
N-terminal
         (801 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    23   9.8  

>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 23.0 bits (47), Expect = 9.8
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 2/32 (6%)

Query: 11  DSG--PEVQINFPSSVMSRIEELMGGTEQFDS 40
           DSG   E+  +FP SV     EL G  + F+S
Sbjct: 380 DSGYTNEIDFSFPDSVSDYPLELKGSPDGFES 411


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.318    0.131    0.376 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 199,538
Number of Sequences: 429
Number of extensions: 7549
Number of successful extensions: 13
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 12
Number of HSP's gapped (non-prelim): 1
length of query: 801
length of database: 140,377
effective HSP length: 63
effective length of query: 738
effective length of database: 113,350
effective search space: 83652300
effective search space used: 83652300
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 47 (23.0 bits)