BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001362-TA|BGIBMGA001362-PA|undefined (60 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41994-6|AAK31526.1| 1286|Caenorhabditis elegans Hypothetical pr... 26 2.7 Z54269-1|CAA91022.2| 815|Caenorhabditis elegans Hypothetical pr... 25 8.3 >U41994-6|AAK31526.1| 1286|Caenorhabditis elegans Hypothetical protein F59A6.5 protein. Length = 1286 Score = 26.2 bits (55), Expect = 2.7 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Query: 13 TRTSSLDQLD--FQERRQLIASSLSLTDFLH 41 T+ LD+L+ QE++Q IA S L +LH Sbjct: 624 TKEDKLDKLEEELQEKKQQIAESKELVTYLH 654 >Z54269-1|CAA91022.2| 815|Caenorhabditis elegans Hypothetical protein F02C12.1 protein. Length = 815 Score = 24.6 bits (51), Expect = 8.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Query: 18 LDQLDFQERRQLIASSLSLTDFLHVGAKEVAA 49 L LD + + +L AS +T +L+VG ++AA Sbjct: 650 LQALDARGQSKLPASKQKITTYLNVGWDDIAA 681 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.317 0.128 0.338 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,017,904 Number of Sequences: 27539 Number of extensions: 23185 Number of successful extensions: 61 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 60 Number of HSP's gapped (non-prelim): 3 length of query: 60 length of database: 12,573,161 effective HSP length: 41 effective length of query: 19 effective length of database: 11,444,062 effective search space: 217437178 effective search space used: 217437178 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -