BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001360-TA|BGIBMGA001360-PA|undefined (141 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0232 - 16053034-16053597 27 4.3 10_08_0229 - 16016818-16017387 27 7.5 05_06_0192 - 26273599-26274543 26 9.9 >10_08_0232 - 16053034-16053597 Length = 187 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 12/15 (80%) Query: 111 SGGTKGGDAEGQAEG 125 +GGT GGD EGQA G Sbjct: 109 AGGTGGGDGEGQAGG 123 >10_08_0229 - 16016818-16017387 Length = 189 Score = 26.6 bits (56), Expect = 7.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 104 PVVAQGNSGGTKGGDAEGQAEG 125 P N+GGT GG+ G+A+G Sbjct: 103 PYRGSSNAGGTGGGEGGGRADG 124 >05_06_0192 - 26273599-26274543 Length = 314 Score = 26.2 bits (55), Expect = 9.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 5 VSAPAITLGRSDGPLVASLDLPDEDGDATAF 35 V PA +GR +G + D+P E D T+F Sbjct: 275 VGNPARLIGRKNGEVEKDEDMPGESMDHTSF 305 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.308 0.130 0.356 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,579,224 Number of Sequences: 37544 Number of extensions: 67533 Number of successful extensions: 208 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 205 Number of HSP's gapped (non-prelim): 3 length of query: 141 length of database: 14,793,348 effective HSP length: 75 effective length of query: 66 effective length of database: 11,977,548 effective search space: 790518168 effective search space used: 790518168 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -