BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001357-TA|BGIBMGA001357-PA|undefined (295 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_05_0006 - 20030673-20030895,20031432-20031478,20031597-200316... 29 4.4 07_03_0481 - 18572206-18574314,18574591-18575185,18575304-185753... 28 7.8 >09_05_0006 - 20030673-20030895,20031432-20031478,20031597-20031665, 20032590-20032725,20032900-20033067,20034286-20034354, 20034535-20034631,20034742-20034820,20035702-20035872 Length = 352 Score = 29.1 bits (62), Expect = 4.4 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 11/52 (21%) Query: 205 VQRGRSPPARPPLCPVNFTDKVVTTDVDRSEGLQKPQIMN-QTILNKTGRCS 255 VQ G S +PPLC D+DR GL++ + T+L+ GRCS Sbjct: 149 VQEGSSIGMKPPLC----------LDMDRMSGLRERDVSRIGTLLDSIGRCS 190 >07_03_0481 - 18572206-18574314,18574591-18575185,18575304-18575371, 18577344-18577458,18578179-18578333,18578673-18580621, 18580691-18581372,18581550-18581621,18582558-18583199, 18583301-18583402,18585011-18585100 Length = 2192 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 209 RSPPARPPLCPVNFTDKVVTTDVDRSEGLQKPQI 242 R+PP++PP C + T + V G QKP I Sbjct: 1909 RAPPSKPPECELPATVSAIAQSVCLLLGEQKPAI 1942 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.317 0.132 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,619,719 Number of Sequences: 37544 Number of extensions: 267076 Number of successful extensions: 509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 508 Number of HSP's gapped (non-prelim): 2 length of query: 295 length of database: 14,793,348 effective HSP length: 82 effective length of query: 213 effective length of database: 11,714,740 effective search space: 2495239620 effective search space used: 2495239620 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -