Silkworm BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001357-TA|BGIBMGA001357-PA|undefined
         (295 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z79696-1|CAB01972.1| 1584|Caenorhabditis elegans Hypothetical pr...    28   6.9  

>Z79696-1|CAB01972.1| 1584|Caenorhabditis elegans Hypothetical protein
            F54F3.1 protein.
          Length = 1584

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%)

Query: 180  DHNRTQKCKTYKIIMNKLDELNRVFVQRGRSPPARPPLC 218
            DHNR  +C+ Y   M   D  N V + +    PA+P  C
Sbjct: 1030 DHNRQYRCECYAAFMG--DGYNCVPLAKPNMVPAQPKTC 1066


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.317    0.132    0.382 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,299,087
Number of Sequences: 27539
Number of extensions: 222953
Number of successful extensions: 507
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 506
Number of HSP's gapped (non-prelim): 2
length of query: 295
length of database: 12,573,161
effective HSP length: 81
effective length of query: 214
effective length of database: 10,342,502
effective search space: 2213295428
effective search space used: 2213295428
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 59 (27.9 bits)