BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001357-TA|BGIBMGA001357-PA|undefined (295 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2FV56 Cluster: Putative uncharacterized protein; n=2; ... 35 2.9 UniRef50_A7RXM7 Cluster: Predicted protein; n=1; Nematostella ve... 33 8.8 >UniRef50_A2FV56 Cluster: Putative uncharacterized protein; n=2; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 499 Score = 34.7 bits (76), Expect = 2.9 Identities = 31/105 (29%), Positives = 50/105 (47%), Gaps = 6/105 (5%) Query: 180 DHNRTQKCKTYKIIMNKLD--ELNRVFVQRGRSPPARPPLCPVNFTDKVVTTDVDRSEGL 237 D + KCK +N+LD E+N + + P L P+ D + DR+ + Sbjct: 59 DMSTEVKCKKILETINELDSREINFLLLICSDIEKQYPSLIPL--LDSSLIVAADRANTV 116 Query: 238 QKPQIMNQTILNKTGRCSPYGREHIVMRSMTQAYAVDI-APKEVS 281 K QI+ + I NKT R + Y I+++ + Q A DI + E+S Sbjct: 117 SKLQILQKYIENKT-RKTEYDFGFIIIQKIKQNIATDIQSSNEIS 160 >UniRef50_A7RXM7 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 491 Score = 33.1 bits (72), Expect = 8.8 Identities = 14/52 (26%), Positives = 26/52 (50%) Query: 100 LMKRQQQPLKEDSSIRDFRVVCEKALLEQQKQLARVTQLCEKLTERQATEIK 151 + K + +K D R+ + E+ LE + +++ Q CEKL E + +K Sbjct: 177 IKKGMESAIKSDKDYREMYMKTERTRLEWEATMSKYCQTCEKLEEERVGHLK 228 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.317 0.132 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 279,300,708 Number of Sequences: 1657284 Number of extensions: 9534806 Number of successful extensions: 20233 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 20232 Number of HSP's gapped (non-prelim): 2 length of query: 295 length of database: 575,637,011 effective HSP length: 100 effective length of query: 195 effective length of database: 409,908,611 effective search space: 79932179145 effective search space used: 79932179145 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 72 (33.1 bits)
- SilkBase 1999-2023 -