GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001357-TA|BGIBMGA001357-PA|undefined
         (295 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    21   8.3  

>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 21.4 bits (43), Expect = 8.3
 Identities = 11/45 (24%), Positives = 18/45 (40%)

Query: 217 LCPVNFTDKVVTTDVDRSEGLQKPQIMNQTILNKTGRCSPYGREH 261
           LC V +T KV   ++   +     +++    L   G C   G  H
Sbjct: 124 LCGVGWTGKVCDVEMVSCKDAALRKVVPLKKLCNNGTCEDIGNSH 168


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.317    0.132    0.382 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 56,126
Number of Sequences: 317
Number of extensions: 1983
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 295
length of database: 114,650
effective HSP length: 56
effective length of query: 239
effective length of database: 96,898
effective search space: 23158622
effective search space used: 23158622
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 43 (21.4 bits)