BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001354-TA|BGIBMGA001354-PA|undefined (260 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006624-7|AAF39787.1| 642|Caenorhabditis elegans Hypothetical ... 28 5.8 AF099916-2|AAC68776.1| 1145|Caenorhabditis elegans Hypothetical ... 28 7.7 >AC006624-7|AAF39787.1| 642|Caenorhabditis elegans Hypothetical protein C53D5.5 protein. Length = 642 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query: 236 DPKNIIYYKIRN-QLICGSTPPRSLA 260 D KN+IY K++N + +CG PP A Sbjct: 332 DSKNVIYTKLKNGRGVCGPPPPSGSA 357 >AF099916-2|AAC68776.1| 1145|Caenorhabditis elegans Hypothetical protein F54C4.3 protein. Length = 1145 Score = 27.9 bits (59), Expect = 7.7 Identities = 19/76 (25%), Positives = 31/76 (40%), Gaps = 1/76 (1%) Query: 113 SLAEFTRGAHVAPHSSELDLTDEGCTCSLATDRSSLARLTSRQLAAGVNRHAKTLSMLLK 172 SL+ R H P E D G L R+T++QL G + KT+ + Sbjct: 35 SLSAHKRHRHPRPEGQEDDKKPRGRPKKYEDSPVPLQRVTTKQLLGG-RKRPKTIVECVD 93 Query: 173 ETALRDRMSVTWFHSV 188 ++A+R + H + Sbjct: 94 DSAIRTDKEASRLHGL 109 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.316 0.130 0.406 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,240,101 Number of Sequences: 27539 Number of extensions: 237199 Number of successful extensions: 589 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 589 Number of HSP's gapped (non-prelim): 2 length of query: 260 length of database: 12,573,161 effective HSP length: 80 effective length of query: 180 effective length of database: 10,370,041 effective search space: 1866607380 effective search space used: 1866607380 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -