SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001353-TA|BGIBMGA001353-PA|IPR005052|Legume-like lectin
         (280 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyc...    25   9.1  

>SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 410

 Score = 25.4 bits (53), Expect = 9.1
 Identities = 13/46 (28%), Positives = 24/46 (52%)

Query: 76  DGEFDDWFESDGQRELRQIFQGQAQIHDVLRDLNKKVDEVIGKQMN 121
           DG    + +   Q  LR I  G+A +H +   +N+ +D V+  +M+
Sbjct: 227 DGPIYTYDDPANQEMLRYINSGRAPLHLLGVSMNQPIDVVVQHRMD 272


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.322    0.135    0.380 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 856,320
Number of Sequences: 5004
Number of extensions: 24574
Number of successful extensions: 50
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 49
Number of HSP's gapped (non-prelim): 1
length of query: 280
length of database: 2,362,478
effective HSP length: 72
effective length of query: 208
effective length of database: 2,002,190
effective search space: 416455520
effective search space used: 416455520
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 53 (25.4 bits)

- SilkBase 1999-2023 -