BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001352-TA|BGIBMGA001352-PA|IPR005052|Legume-like lectin, IPR008985|Concanavalin A-like lectin/glucanase (206 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0261 + 27978341-27978391,27978539-27978683,27978794-279788... 31 0.50 >01_06_0261 + 27978341-27978391,27978539-27978683,27978794-27978861, 27979630-27980073,27980163-27980681,27981002-27981214, 27981650-27981805,27982753-27982941 Length = 594 Score = 31.5 bits (68), Expect = 0.50 Identities = 14/35 (40%), Positives = 22/35 (62%) Query: 113 NGMTNNEQDYELCFRAENVVLPRGGHFGLSAATGG 147 NG + + L ++N + P+GGH+GLS+A GG Sbjct: 291 NGYGDCDISDNLTDNSKNSLSPQGGHYGLSSAGGG 325 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.324 0.138 0.434 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,834,691 Number of Sequences: 37544 Number of extensions: 240271 Number of successful extensions: 406 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 405 Number of HSP's gapped (non-prelim): 1 length of query: 206 length of database: 14,793,348 effective HSP length: 79 effective length of query: 127 effective length of database: 11,827,372 effective search space: 1502076244 effective search space used: 1502076244 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -