BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001350-TA|BGIBMGA001350-PA|IPR001251|Cellular retinaldehyde-binding/triple function, C-terminal (507 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 25 1.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 8.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 8.7 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 8.7 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 24.6 bits (51), Expect = 1.6 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 4/50 (8%) Query: 273 SMESEEEPVELDNARSCPDPRSE----DDDDTKRSKSTNTVSESSDLIPE 318 S+ S++E E+++ S D E DDDDT +S + S + LIP+ Sbjct: 18 SLLSKKEDEEVEHRLSDRDDDDENITVDDDDTDGRESLSPSSAHTVLIPQ 67 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 8.7 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 97 LSSPDENF-PDLIPKKVHKIEDEKDLSLSSIEDER 130 L+ +E F +LI + +H IED+K + ++D R Sbjct: 1188 LNRNEETFWNELIEQYLHPIEDDKKKVSAELKDLR 1222 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 8.7 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 97 LSSPDENF-PDLIPKKVHKIEDEKDLSLSSIEDER 130 L+ +E F +LI + +H IED+K + ++D R Sbjct: 1188 LNRNEETFWNELIEQYLHPIEDDKKKVSAELKDLR 1222 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 22.2 bits (45), Expect = 8.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Query: 489 PVEPNAIPET 498 PV+PNAIP T Sbjct: 9 PVQPNAIPTT 18 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.132 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,505 Number of Sequences: 317 Number of extensions: 5644 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 4 length of query: 507 length of database: 114,650 effective HSP length: 60 effective length of query: 447 effective length of database: 95,630 effective search space: 42746610 effective search space used: 42746610 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -