BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001350-TA|BGIBMGA001350-PA|IPR001251|Cellular retinaldehyde-binding/triple function, C-terminal (507 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ435338-1|ABD92653.1| 135|Apis mellifera OBP21 protein. 23 4.5 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 6.0 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 7.9 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 7.9 >DQ435338-1|ABD92653.1| 135|Apis mellifera OBP21 protein. Length = 135 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/32 (28%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query: 39 ILRFSDHDKI-NFNDSLIHKMSNLHLDSPKIN 69 I +F+ +D NFN+ ++ +++ ++LD ++N Sbjct: 67 IKKFNAYDDGGNFNEVVVREIAEIYLDENEVN 98 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.0 bits (47), Expect = 6.0 Identities = 7/21 (33%), Positives = 14/21 (66%) Query: 260 EDDRCSLDSVSGCSMESEEEP 280 ED +CS++S++ + S +P Sbjct: 399 EDQKCSIESITSVNSTSSPKP 419 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.6 bits (46), Expect = 7.9 Identities = 13/35 (37%), Positives = 15/35 (42%) Query: 135 SPQRNTSKNNLYFTENFVTADSQILNDTLDLPPDV 169 S Q+ SK N E S L D LD+ DV Sbjct: 277 SAQKTESKTNNIVVEGVSFGQSVGLKDDLDIDDDV 311 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 97 LSSPDENFPDLIPKKVHKIEDEKDL 121 +S DE+ D+ P+K + E EK L Sbjct: 431 MSGLDESLSDVTPRKKYPFELEKAL 455 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.132 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,442 Number of Sequences: 429 Number of extensions: 6943 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 4 length of query: 507 length of database: 140,377 effective HSP length: 61 effective length of query: 446 effective length of database: 114,208 effective search space: 50936768 effective search space used: 50936768 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -