SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001348-TA|BGIBMGA001348-PA|IPR001810|Cyclin-like F-box,
IPR006553|Leucine-rich repeat, cysteine-containing subtype,
IPR001395|Aldo/keto reductase
         (595 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter...    23   5.4  
AJ555537-1|CAD88245.1|  210|Apis mellifera putative chemosensory...    23   7.1  

>AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter
           Am-EAAT protein.
          Length = 543

 Score = 23.4 bits (48), Expect = 5.4
 Identities = 7/11 (63%), Positives = 10/11 (90%)

Query: 242 GVVVMGYSPFG 252
           G+++M YSPFG
Sbjct: 280 GIIIMWYSPFG 290


>AJ555537-1|CAD88245.1|  210|Apis mellifera putative chemosensory
           receptor 2 protein.
          Length = 210

 Score = 23.0 bits (47), Expect = 7.1
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 226 HLQNVQKEMVEFCQSEGVVVMGYSPFGSLVARHGSTVEGPKIDDPV 271
           HL+N+ K ++EF  +   VV    P    + + GS  E PK  +P+
Sbjct: 4   HLKNIMKPLMEFSATLDTVV----PNSGELFKAGS-AEQPKEQEPL 44


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.319    0.136    0.410 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 156,647
Number of Sequences: 429
Number of extensions: 6840
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 8
Number of HSP's gapped (non-prelim): 2
length of query: 595
length of database: 140,377
effective HSP length: 62
effective length of query: 533
effective length of database: 113,779
effective search space: 60644207
effective search space used: 60644207
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 46 (22.6 bits)

- SilkBase 1999-2023 -