BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001347-TA|BGIBMGA001347-PA|IPR009911|Fibroin P25 (220 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44234| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_47759| Best HMM Match : ASC (HMM E-Value=1.49939e-42) 30 1.3 >SB_44234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 31.9 bits (69), Expect = 0.43 Identities = 16/44 (36%), Positives = 22/44 (50%) Query: 135 SYPLIRLTTVFDKGNNFDLCSAFTFADLAGGLPIFHINPNDQRT 178 S+ + +F NF + F DL+ LPIFHI ND+ T Sbjct: 162 SHTATLIDNMFCNRPNFSQIADILFNDLSDHLPIFHICTNDENT 205 >SB_47759| Best HMM Match : ASC (HMM E-Value=1.49939e-42) Length = 464 Score = 30.3 bits (65), Expect = 1.3 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Query: 93 NVRTLKTVLTVDCPWLNFESNRTLAQHMSFKEDVVLSFYINGSYPLIRLTTVFDKGNNFD 152 NV TL+++ T W N A SFKE +VL Y G YP + ++ NN Sbjct: 159 NVTTLRSLYTKS--WSNVPEQFIKAYSASFKETIVLCRY--GLYP-CNMKLFTEQVNNIG 213 Query: 153 LCSAF 157 C +F Sbjct: 214 RCFSF 218 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.327 0.141 0.464 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,349,410 Number of Sequences: 59808 Number of extensions: 298631 Number of successful extensions: 631 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 630 Number of HSP's gapped (non-prelim): 2 length of query: 220 length of database: 16,821,457 effective HSP length: 79 effective length of query: 141 effective length of database: 12,096,625 effective search space: 1705624125 effective search space used: 1705624125 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -