BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001347-TA|BGIBMGA001347-PA|IPR009911|Fibroin P25 (220 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 25 0.42 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 25 0.42 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 25.4 bits (53), Expect = 0.42 Identities = 14/58 (24%), Positives = 27/58 (46%) Query: 67 YFNATYVDHNLITRNHDKCRVSEFYDNVRTLKTVLTVDCPWLNFESNRTLAQHMSFKE 124 YF+ TY+ + + H+K ++E + TL+ + + L + TL Q + E Sbjct: 39 YFHHTYIIYESLCGRHEKRLLNELLSSYNTLERPVANESEPLEVKFGITLQQIIDVDE 96 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 25.4 bits (53), Expect = 0.42 Identities = 14/58 (24%), Positives = 27/58 (46%) Query: 67 YFNATYVDHNLITRNHDKCRVSEFYDNVRTLKTVLTVDCPWLNFESNRTLAQHMSFKE 124 YF+ TY+ + + H+K ++E + TL+ + + L + TL Q + E Sbjct: 39 YFHHTYIIYESLCGRHEKRLLNELLSSYNTLERPVANESEPLEVKFGITLQQIIDVDE 96 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.327 0.141 0.464 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,228 Number of Sequences: 429 Number of extensions: 2804 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 220 length of database: 140,377 effective HSP length: 55 effective length of query: 165 effective length of database: 116,782 effective search space: 19269030 effective search space used: 19269030 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -