BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001345-TA|BGIBMGA001345-PA|undefined (62 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 0.41 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 19 2.9 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 19 5.1 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 18 8.9 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 18 8.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 18 8.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 18 8.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 0.41 Identities = 11/31 (35%), Positives = 14/31 (45%) Query: 1 MASLNITLIPQRFRVTLTDRPPGEGHSTPYK 31 MA ++P + T T RP G S YK Sbjct: 2292 MAPSTTPMVPDKPVTTTTSRPIGTDTSDDYK 2322 Score = 17.8 bits (34), Expect = 8.9 Identities = 5/10 (50%), Positives = 8/10 (80%) Query: 46 WSTTWAKKTT 55 W+TT ++TT Sbjct: 1052 WTTTTTRRTT 1061 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 19.4 bits (38), Expect = 2.9 Identities = 8/24 (33%), Positives = 13/24 (54%) Query: 10 PQRFRVTLTDRPPGEGHSTPYKNN 33 PQ+ ++TD +G + P NN Sbjct: 699 PQQRSPSVTDLSTKDGTTVPESNN 722 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 18.6 bits (36), Expect = 5.1 Identities = 8/20 (40%), Positives = 10/20 (50%) Query: 9 IPQRFRVTLTDRPPGEGHST 28 + +R VT D P GH T Sbjct: 215 VKKREEVTQKDSPMNMGHLT 234 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 17.8 bits (34), Expect = 8.9 Identities = 6/13 (46%), Positives = 8/13 (61%) Query: 46 WSTTWAKKTTGYE 58 W+ + KK GYE Sbjct: 195 WTGIFQKKWRGYE 207 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 17.8 bits (34), Expect = 8.9 Identities = 6/18 (33%), Positives = 11/18 (61%) Query: 39 RTPLEMRWSTTWAKKTTG 56 R P + + T+W++K G Sbjct: 520 RPPQVLCYITSWSQKRPG 537 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 17.8 bits (34), Expect = 8.9 Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 32 NNREGAGRTPLEMRWSTTWAKKTTG 56 N E P+EMR + + +T+G Sbjct: 1356 NEYEDQTEVPVEMRKTVSNLAQTSG 1380 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 17.8 bits (34), Expect = 8.9 Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 32 NNREGAGRTPLEMRWSTTWAKKTTG 56 N E P+EMR + + +T+G Sbjct: 1356 NEYEDQTEVPVEMRKTVSNLAQTSG 1380 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.129 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,839 Number of Sequences: 317 Number of extensions: 581 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 62 length of database: 114,650 effective HSP length: 42 effective length of query: 20 effective length of database: 101,336 effective search space: 2026720 effective search space used: 2026720 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.3 bits) S2: 34 (17.8 bits)
- SilkBase 1999-2023 -