BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001345-TA|BGIBMGA001345-PA|undefined (62 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC146.04 |||sulfhydryl oxidase |Schizosaccharomyces pombe|chr ... 22 8.3 SPAC4D7.13 |usp104|prp40|U1 snRNP-associated protein Usp104|Schi... 22 8.3 >SPBC146.04 |||sulfhydryl oxidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 192 Score = 22.2 bits (45), Expect = 8.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 33 NREGAGRTPLEM 44 +REG GR P+EM Sbjct: 45 DREGQGRKPIEM 56 >SPAC4D7.13 |usp104|prp40|U1 snRNP-associated protein Usp104|Schizosaccharomyces pombe|chr 1|||Manual Length = 695 Score = 22.2 bits (45), Expect = 8.3 Identities = 11/33 (33%), Positives = 16/33 (48%) Query: 30 YKNNREGAGRTPLEMRWSTTWAKKTTGYESRNV 62 Y N +G TPL++ W T + E RN+ Sbjct: 444 YLNLLGQSGSTPLDLFWDTIVDLENMYREKRNL 476 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.313 0.129 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 318,054 Number of Sequences: 5004 Number of extensions: 10665 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 62 length of database: 2,362,478 effective HSP length: 43 effective length of query: 19 effective length of database: 2,147,306 effective search space: 40798814 effective search space used: 40798814 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -