BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001345-TA|BGIBMGA001345-PA|undefined (62 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 25 0.20 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 21 4.3 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 21 4.3 Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. 20 7.4 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 20 7.4 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 25.4 bits (53), Expect = 0.20 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Query: 13 FRVTLTDRPPGEGHSTPYKNNREGAGRTPLEMRWSTTWA 51 F V+L + P S P + EG G L M W ++W+ Sbjct: 170 FNVSLAELEPNFTPSHPVSFS-EGIGNRTLYMSWPSSWS 207 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 21.0 bits (42), Expect = 4.3 Identities = 9/21 (42%), Positives = 11/21 (52%) Query: 9 IPQRFRVTLTDRPPGEGHSTP 29 +PQR T PG G +TP Sbjct: 10 LPQRTTATSLPVAPGTGPTTP 30 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 21.0 bits (42), Expect = 4.3 Identities = 9/26 (34%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Query: 32 NNREGAGRTPLEMR-WSTTWAKKTTG 56 N R+ P + W + WA +TTG Sbjct: 183 NLRDEKNELPADFNEWLSRWALETTG 208 >Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 20.2 bits (40), Expect = 7.4 Identities = 9/25 (36%), Positives = 11/25 (44%) Query: 32 NNREGAGRTPLEMRWSTTWAKKTTG 56 N R G + L +W T A T G Sbjct: 68 NKRHNCGGSVLSSKWVLTAAHCTAG 92 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 20.2 bits (40), Expect = 7.4 Identities = 9/25 (36%), Positives = 11/25 (44%) Query: 32 NNREGAGRTPLEMRWSTTWAKKTTG 56 N R G + L +W T A T G Sbjct: 68 NKRHNCGGSVLSSKWVLTAAHCTAG 92 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.313 0.129 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,678 Number of Sequences: 2123 Number of extensions: 2639 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 62 length of database: 516,269 effective HSP length: 41 effective length of query: 21 effective length of database: 429,226 effective search space: 9013746 effective search space used: 9013746 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.6 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -