GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001343-TA|BGIBMGA001343-PA|IPR000608|Ubiquitin-
conjugating enzyme, E2
         (201 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U77974-1|AAB36556.1|  276|Tribolium castaneum transcription fact...    22   3.9  

>U77974-1|AAB36556.1|  276|Tribolium castaneum transcription factor
           homolog protein.
          Length = 276

 Score = 21.8 bits (44), Expect = 3.9
 Identities = 10/34 (29%), Positives = 13/34 (38%), Gaps = 1/34 (2%)

Query: 125 FMQKVRECVVTSID-HIYDDPPTEDKHYITFKPY 157
           F   +     TS+  H    PP    HY  + PY
Sbjct: 146 FAASIFHAAATSLPLHYPPPPPVYTHHYARYHPY 179


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.322    0.138    0.434 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 52,931
Number of Sequences: 317
Number of extensions: 2428
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 201
length of database: 114,650
effective HSP length: 54
effective length of query: 147
effective length of database: 97,532
effective search space: 14337204
effective search space used: 14337204
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 41 (20.6 bits)