BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001341-TA|BGIBMGA001341-PA|undefined (220 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 1.9 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 5.8 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 5.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.8 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 7.6 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 7.6 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 21 7.6 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 23.0 bits (47), Expect = 1.9 Identities = 13/51 (25%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Query: 77 RIRLNKTGKYEAEFPFVSHCGRERNYIRCDDLPIVFTHI-FHEDNVDFLSY 126 +++L G YE + ++ N + CD+ HI +H D D Y Sbjct: 887 KVKLEYDGPYETSISSGQYTTKDPNEVTCDEEE---GHISYHPDKADCRMY 934 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/37 (32%), Positives = 15/37 (40%) Query: 139 PDKVYMLPLTGRVYHVAEEKFGGVGLIKSKLAIELSK 175 P KVY P GR+ K + +K K I K Sbjct: 85 PPKVYPTPYGGRLVWTLPGKTKMIAHLKDKKKIRAKK 121 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/37 (32%), Positives = 15/37 (40%) Query: 139 PDKVYMLPLTGRVYHVAEEKFGGVGLIKSKLAIELSK 175 P KVY P GR+ K + +K K I K Sbjct: 399 PPKVYPTPYGGRLVWTLPGKTKMIAHLKDKKKIRAKK 435 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/37 (32%), Positives = 15/37 (40%) Query: 139 PDKVYMLPLTGRVYHVAEEKFGGVGLIKSKLAIELSK 175 P KVY P GR+ K + +K K I K Sbjct: 632 PPKVYPTPYGGRLVWTLPGKTKMIAHLKDKKKIRAKK 668 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/37 (32%), Positives = 15/37 (40%) Query: 139 PDKVYMLPLTGRVYHVAEEKFGGVGLIKSKLAIELSK 175 P KVY P GR+ K + +K K I K Sbjct: 632 PPKVYPTPYGGRLVWTLPGKTKMIAHLKDKKKIRAKK 668 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 7.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 141 KVYMLPLTGRVYHVAEEKF 159 K + LT ++Y V EEK+ Sbjct: 206 KPFFKLLTSKIYKVLEEKY 224 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 7.6 Identities = 7/10 (70%), Positives = 8/10 (80%) Query: 178 EFHNGDTRPP 187 +F NGD RPP Sbjct: 551 QFCNGDNRPP 560 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 21.0 bits (42), Expect = 7.6 Identities = 8/17 (47%), Positives = 9/17 (52%) Query: 195 KKYELDLNWFDENVKRF 211 K LDL W EN+ F Sbjct: 163 KDMVLDLKWVQENIIHF 179 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.324 0.142 0.445 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 55,854 Number of Sequences: 317 Number of extensions: 2389 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 9 length of query: 220 length of database: 114,650 effective HSP length: 54 effective length of query: 166 effective length of database: 97,532 effective search space: 16190312 effective search space used: 16190312 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.5 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -