Silkworm BLAST Result against rice

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001341-TA|BGIBMGA001341-PA|undefined
         (220 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_04_0122 + 18198594-18202269,18202551-18202591,18203273-182032...    27   9.1  

>05_04_0122 +
           18198594-18202269,18202551-18202591,18203273-18203281,
           18203336-18203551,18204257-18204361,18204761-18204919
          Length = 1401

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 13/50 (26%), Positives = 25/50 (50%)

Query: 8   KIAKITDIIPQICSQKKSLHYVQGQEPEPKIREYFYYIDHQGMLFLDDAR 57
           K+ +I + I Q+ SQ     ++    PE +  + + Y+D Q ++  D  R
Sbjct: 122 KLQQIVEQIDQLVSQMNQFGFLNCPMPEDERMQTYSYVDEQEVIGRDKER 171


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.324    0.142    0.445 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,495,692
Number of Sequences: 37544
Number of extensions: 261023
Number of successful extensions: 528
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 527
Number of HSP's gapped (non-prelim): 1
length of query: 220
length of database: 14,793,348
effective HSP length: 79
effective length of query: 141
effective length of database: 11,827,372
effective search space: 1667659452
effective search space used: 1667659452
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.5 bits)
S2: 58 (27.5 bits)