BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001341-TA|BGIBMGA001341-PA|undefined (220 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35416| Best HMM Match : Cyanate_lyase (HMM E-Value=0.076) 27 9.3 SB_18736| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_26485| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_35416| Best HMM Match : Cyanate_lyase (HMM E-Value=0.076) Length = 646 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 21 SQKKSLHYVQGQEPEPKIREYFYYIDH-QGMLFLDDARIKNFTS 63 S KKS+H V G+EP ++ + ++ G D A+ K FTS Sbjct: 432 SSKKSVHNVYGEEPPQRVYKCGGHVGRSHGNNLKDFAKQKAFTS 475 >SB_18736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1452 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 21 SQKKSLHYVQGQEPEPKIREYFYYIDH-QGMLFLDDARIKNFTS 63 S KKS+H V G+EP ++ + ++ G D A+ K FTS Sbjct: 640 SSKKSVHNVYGEEPPQRVYKCGGHVGRSHGNNLKDFAKQKAFTS 683 >SB_26485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 21 SQKKSLHYVQGQEPEPKIREYFYYIDH-QGMLFLDDARIKNFTS 63 S KKS+H V G+EP ++ + ++ G D A+ K FTS Sbjct: 451 SSKKSVHNVYGEEPPQRVYKCGGHVGRSHGNNLKDFAKQKAFTS 494 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.324 0.142 0.445 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,579,624 Number of Sequences: 59808 Number of extensions: 300938 Number of successful extensions: 627 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 627 Number of HSP's gapped (non-prelim): 3 length of query: 220 length of database: 16,821,457 effective HSP length: 79 effective length of query: 141 effective length of database: 12,096,625 effective search space: 1705624125 effective search space used: 1705624125 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.5 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -