BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001338-TA|BGIBMGA001338-PA|IPR002213|UDP- glucuronosyl/UDP-glucosyltransferase (365 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 22 9.5 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 22 9.5 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.8 bits (44), Expect = 9.5 Identities = 10/37 (27%), Positives = 19/37 (51%) Query: 153 TRRELLDVFGSIPQTVLWKFEEDLQDLPKNVHIRSWM 189 T L+ G I + + KFE++ Q++ K +W+ Sbjct: 23 TTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 59 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.8 bits (44), Expect = 9.5 Identities = 10/37 (27%), Positives = 19/37 (51%) Query: 153 TRRELLDVFGSIPQTVLWKFEEDLQDLPKNVHIRSWM 189 T L+ G I + + KFE++ Q++ K +W+ Sbjct: 23 TTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWV 59 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.135 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,403 Number of Sequences: 429 Number of extensions: 4252 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 365 length of database: 140,377 effective HSP length: 59 effective length of query: 306 effective length of database: 115,066 effective search space: 35210196 effective search space used: 35210196 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -