BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001337-TA|BGIBMGA001337-PA|undefined (200 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 24 2.7 AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. 23 6.3 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 24.2 bits (50), Expect = 2.7 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Query: 95 QLPPFFYLSSFLAVDMHEQRNSNTGVSFVKALAENITRVSLATPALQQAIVQ 146 +LP F++ + + V + ++NT S V + N + TP Q A++Q Sbjct: 473 ELPYLFHIPAAMLVPVSPDSHANTVSSRVVRMWTNFAKTGNPTPG-QDALLQ 523 >AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. Length = 401 Score = 23.0 bits (47), Expect = 6.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 136 ATPALQQAIVQGKYDAVIT 154 A LQ A++ G YD ++T Sbjct: 259 ALKRLQAAVIAGSYDEIVT 277 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.134 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,051 Number of Sequences: 2123 Number of extensions: 5871 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 22 Number of HSP's gapped (non-prelim): 2 length of query: 200 length of database: 516,269 effective HSP length: 61 effective length of query: 139 effective length of database: 386,766 effective search space: 53760474 effective search space used: 53760474 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -