BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001332-TA|BGIBMGA001332-PA|undefined (198 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79759-1|CAB02138.2| 841|Caenorhabditis elegans Hypothetical pr... 28 5.1 Z81485-5|CAB03976.1| 151|Caenorhabditis elegans Hypothetical pr... 27 9.0 >Z79759-1|CAB02138.2| 841|Caenorhabditis elegans Hypothetical protein ZK858.1 protein. Length = 841 Score = 27.9 bits (59), Expect = 5.1 Identities = 15/61 (24%), Positives = 29/61 (47%) Query: 121 MALVHLGLPGWQAAFANLPMIPWAEQLFLLLAPHLLEKADSENNSASVNNETGLNHIDPN 180 MA+V++G ++ A PM P + + HL + + ++ S + T L+H P Sbjct: 761 MAVVNVGRGSYRNALTTSPMTPPSAHTSMQKQHHLRKDNECGFDNNSATSSTDLSHHQPQ 820 Query: 181 I 181 + Sbjct: 821 L 821 >Z81485-5|CAB03976.1| 151|Caenorhabditis elegans Hypothetical protein C49F5.5 protein. Length = 151 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Query: 145 EQLFLLLAPHLLEKADSENNSASVNNE 171 EQL LLL ++ K D EN A++N + Sbjct: 56 EQLILLLHANVCTKRDRENYQAAINGQ 82 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.323 0.135 0.470 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,312,468 Number of Sequences: 27539 Number of extensions: 216781 Number of successful extensions: 380 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 378 Number of HSP's gapped (non-prelim): 2 length of query: 198 length of database: 12,573,161 effective HSP length: 78 effective length of query: 120 effective length of database: 10,425,119 effective search space: 1251014280 effective search space used: 1251014280 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -