SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001327-TA|BGIBMGA001327-PA|undefined
         (196 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000E476CA Cluster: PREDICTED: similar to KIAA0445 p...    33   3.4  

>UniRef50_UPI0000E476CA Cluster: PREDICTED: similar to KIAA0445
           protein; n=6; Deuterostomia|Rep: PREDICTED: similar to
           KIAA0445 protein - Strongylocentrotus purpuratus
          Length = 2435

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 16/40 (40%), Positives = 27/40 (67%)

Query: 52  NIAWGEIEKMNRIYESEDSQLETRLLNSSADRDHVLMKSQ 91
           N A G +++ NR+ ++E S++E  L +S ADRD + +K Q
Sbjct: 68  NPALGNLQEENRMLQNELSRVEDLLSSSRADRDELAIKYQ 107


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.312    0.132    0.375 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 155,970,904
Number of Sequences: 1657284
Number of extensions: 3743339
Number of successful extensions: 5661
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5660
Number of HSP's gapped (non-prelim): 1
length of query: 196
length of database: 575,637,011
effective HSP length: 97
effective length of query: 99
effective length of database: 414,880,463
effective search space: 41073165837
effective search space used: 41073165837
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 70 (32.3 bits)

- SilkBase 1999-2023 -