BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001325-TA|BGIBMGA001325-PA|IPR004272|Odorant binding protein, IPR013053|Hormone binding (226 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ181567-1|ABA10444.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181566-1|ABA10441.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181565-1|ABA10438.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181564-1|ABA10435.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181563-1|ABA10432.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181562-1|ABA10429.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181561-1|ABA10426.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181560-1|ABA10423.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181559-1|ABA10420.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181558-1|ABA10417.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181557-1|ABA10414.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181556-1|ABA10411.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181555-1|ABA10408.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181554-1|ABA10405.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 DQ181553-1|ABA10402.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 BC033819-1|AAH33819.1| 398|Homo sapiens CADM3 protein protein. 30 5.8 AY663433-1|AAU47325.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663432-1|AAU47322.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663431-1|AAU47319.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663430-1|AAU47316.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663429-1|AAU47313.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663428-1|AAU47310.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663427-1|AAU47307.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663426-1|AAU47304.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663425-1|AAU47301.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663424-1|AAU47298.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663423-1|AAU47295.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663422-1|AAU47292.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663421-1|AAU47289.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663420-1|AAU47286.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663419-1|AAU47283.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663418-1|AAU47280.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663417-1|AAU47277.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY663416-1|AAU47274.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AY358332-1|AAQ88698.1| 398|Homo sapiens GAPA225 protein. 30 5.8 AY046418-1|AAL02143.1| 398|Homo sapiens brain immunoglobulin re... 30 5.8 AL035403-3|CAB56227.1| 432|Homo sapiens immunoglobulin superfam... 30 5.8 AL035403-2|CAI17894.1| 398|Homo sapiens immunoglobulin superfam... 30 5.8 AL035403-1|CAI17893.1| 234|Homo sapiens immunoglobulin superfam... 30 5.8 AF529206-1|AAN75603.1| 234|Homo sapiens dendritic cell nectin-l... 30 5.8 AF363367-1|AAM60749.1| 398|Homo sapiens TSLC1-like 1 protein. 30 5.8 AF062733-1|AAD17540.2| 432|Homo sapiens nectin-like protein 1 p... 30 5.8 >DQ181567-1|ABA10444.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181566-1|ABA10441.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181565-1|ABA10438.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181564-1|ABA10435.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181563-1|ABA10432.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181562-1|ABA10429.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181561-1|ABA10426.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181560-1|ABA10423.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181559-1|ABA10420.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181558-1|ABA10417.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181557-1|ABA10414.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181556-1|ABA10411.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181555-1|ABA10408.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181554-1|ABA10405.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >DQ181553-1|ABA10402.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >BC033819-1|AAH33819.1| 398|Homo sapiens CADM3 protein protein. Length = 398 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 91 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 133 >AY663433-1|AAU47325.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663432-1|AAU47322.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663431-1|AAU47319.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663430-1|AAU47316.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663429-1|AAU47313.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663428-1|AAU47310.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663427-1|AAU47307.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663426-1|AAU47304.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663425-1|AAU47301.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663424-1|AAU47298.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663423-1|AAU47295.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663422-1|AAU47292.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663421-1|AAU47289.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663420-1|AAU47286.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663419-1|AAU47283.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663418-1|AAU47280.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663417-1|AAU47277.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY663416-1|AAU47274.1| 432|Homo sapiens immunoglobulin superfamily member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AY358332-1|AAQ88698.1| 398|Homo sapiens GAPA225 protein. Length = 398 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 91 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 133 >AY046418-1|AAL02143.1| 398|Homo sapiens brain immunoglobulin receptor precursor protein. Length = 398 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 91 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 133 >AL035403-3|CAB56227.1| 432|Homo sapiens immunoglobulin superfamily, member 4B protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 >AL035403-2|CAI17894.1| 398|Homo sapiens immunoglobulin superfamily, member 4B protein. Length = 398 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 91 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 133 >AL035403-1|CAI17893.1| 234|Homo sapiens immunoglobulin superfamily, member 4B protein. Length = 234 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 91 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 133 >AF529206-1|AAN75603.1| 234|Homo sapiens dendritic cell nectin-like protein 1 short isoform protein. Length = 234 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 91 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 133 >AF363367-1|AAM60749.1| 398|Homo sapiens TSLC1-like 1 protein. Length = 398 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 91 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 133 >AF062733-1|AAD17540.2| 432|Homo sapiens nectin-like protein 1 protein. Length = 432 Score = 30.3 bits (65), Expect = 5.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Query: 103 YKLSGKLLVLPIEGEGKYNIKIRDIVIKTANDLVTVTGADGKP 145 ++LS + + + EG+Y I + ++TA LVTV G KP Sbjct: 125 HELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKP 167 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.317 0.137 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,689,674 Number of Sequences: 224733 Number of extensions: 1241764 Number of successful extensions: 5361 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5319 Number of HSP's gapped (non-prelim): 42 length of query: 226 length of database: 73,234,838 effective HSP length: 87 effective length of query: 139 effective length of database: 53,683,067 effective search space: 7461946313 effective search space used: 7461946313 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 64 (29.9 bits)
- SilkBase 1999-2023 -