Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001321-TA|BGIBMGA001321-PA|undefined
         (236 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ138190-1|ABA03054.1|  135|Tribolium castaneum bursicon-like pr...    23   2.7  
AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle nu...    21   8.3  

>DQ138190-1|ABA03054.1|  135|Tribolium castaneum bursicon-like
           protein protein.
          Length = 135

 Score = 22.6 bits (46), Expect = 2.7
 Identities = 8/13 (61%), Positives = 9/13 (69%)

Query: 101 SVSVPNGYLTECY 113
           SV  P G+L ECY
Sbjct: 70  SVITPTGFLKECY 82


>AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle
           nuclear receptor protein.
          Length = 407

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 12/47 (25%), Positives = 22/47 (46%)

Query: 137 ASGRDSPAEWSEPAEGGAEVTLRLRLSSSCRDVELAVCSRHTVAHCK 183
           ASG+       E  +G  + T+R  LS +CR+ +  +  +     C+
Sbjct: 93  ASGKHYGVYSCEGCKGFFKRTVRKDLSYACREEKNCIIDKRQRNRCQ 139


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.319    0.135    0.439 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 56,177
Number of Sequences: 317
Number of extensions: 2302
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of query: 236
length of database: 114,650
effective HSP length: 55
effective length of query: 181
effective length of database: 97,215
effective search space: 17595915
effective search space used: 17595915
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 42 (21.0 bits)