BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001321-TA|BGIBMGA001321-PA|undefined (236 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32413| Best HMM Match : HEAT (HMM E-Value=0.00039) 151 6e-37 >SB_32413| Best HMM Match : HEAT (HMM E-Value=0.00039) Length = 695 Score = 151 bits (365), Expect = 6e-37 Identities = 82/174 (47%), Positives = 109/174 (62%), Gaps = 9/174 (5%) Query: 1 MGGCIGITRSGSGHIEESSGTVSRPNSGGLRKNQSLCHETIRWKSDVPLTEGQLRSKRDE 60 MGGC+G S + SS S P L KNQ L E +W SD+PLTEGQLRSKRDE Sbjct: 1 MGGCMGTGHDPSVRVS-SSEFGSTPGVT-LGKNQPLKKERQQWTSDIPLTEGQLRSKRDE 58 Query: 61 FWDTAPAFDGRKEIWDXXXXXXXXXXXMDFQLAQAILDGASVSVPNGYLTECYDEWGTRY 120 FW+TAPAF+GRKEIWD D LAQAI+DGA++++P G L + YDE GTRY Sbjct: 59 FWETAPAFEGRKEIWDALRAAAETD---DHTLAQAIVDGANITLPTGSLQDAYDELGTRY 115 Query: 121 QVPIYCLSPPINMVK--EASGR-DSPAEWSEPAEGGAEVTLRLRLSSSCRDVEL 171 +P+YC+S P N++K + SG + + E G E ++LRLS+ +D+++ Sbjct: 116 VLPVYCISQPTNLIKDDDVSGDISNEVDEKETPPTGEETYVKLRLSTG-KDLKM 168 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.319 0.135 0.439 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,559,555 Number of Sequences: 59808 Number of extensions: 336215 Number of successful extensions: 721 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 719 Number of HSP's gapped (non-prelim): 1 length of query: 236 length of database: 16,821,457 effective HSP length: 80 effective length of query: 156 effective length of database: 12,036,817 effective search space: 1877743452 effective search space used: 1877743452 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -