BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001318-TA|BGIBMGA001318-PA|IPR002048|Calcium-binding EF-hand (72 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37780.1 68418.m04549 calmodulin-1/4 (CAM1) identical to calm... 116 2e-27 At1g66410.1 68414.m07542 calmodulin-1/4 (CAM4) identical to calm... 116 2e-27 At5g21274.1 68418.m02533 calmodulin-6 (CAM6) identical to calmod... 115 4e-27 At3g56800.1 68416.m06317 calmodulin-2/3/5 (CAM3) identical to ca... 115 4e-27 At3g43810.1 68416.m04682 calmodulin-7 (CAM7) almost identical to... 115 4e-27 At2g41110.1 68415.m05078 calmodulin-2/3/5 (CAM2) (CAL1) almost i... 115 4e-27 At2g27030.3 68415.m03247 calmodulin-2/3/5 (CAM5) (TCH1) identica... 115 4e-27 At2g27030.1 68415.m03245 calmodulin-2/3/5 (CAM5) (TCH1) identica... 115 4e-27 At3g22930.1 68416.m02889 calmodulin, putative strong similarity ... 91 8e-20 At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-r... 89 3e-19 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-r... 89 3e-19 At4g14640.1 68417.m02252 calmodulin-8 (CAM8) identical to calmod... 87 1e-18 At2g41090.1 68415.m05075 calmodulin-like calcium-binding protein... 78 8e-16 At1g12310.1 68414.m01423 calmodulin, putative similar to calmodu... 68 7e-13 At3g51920.1 68416.m05695 calmodulin-9 (CAM9) identical to calmod... 68 9e-13 At1g62820.1 68414.m07092 calmodulin, putative similar to calmodu... 68 9e-13 At3g50360.1 68416.m05507 caltractin / centrin identical to caltr... 60 2e-10 At3g03000.1 68416.m00295 calmodulin, putative similar to calmodu... 55 5e-09 At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDP... 53 2e-08 At2g27030.2 68415.m03246 calmodulin-2/3/5 (CAM5) (TCH1) identica... 52 4e-08 At1g32250.1 68414.m03967 calmodulin, putative similar to calmodu... 52 4e-08 At1g05990.1 68414.m00627 calcium-binding protein, putative stron... 52 4e-08 At5g37770.1 68418.m04547 touch-responsive protein / calmodulin-r... 52 5e-08 At2g43290.1 68415.m05382 calmodulin-like protein (MSS3) identica... 52 5e-08 At1g73630.1 68414.m08524 calcium-binding protein, putative simil... 52 6e-08 At1g24620.1 68414.m03097 polcalcin, putative / calcium-binding p... 51 8e-08 At5g17470.1 68418.m02050 calmodulin-related protein, putative si... 51 1e-07 At5g04870.1 68418.m00510 calcium-dependent protein kinase isofor... 50 1e-07 At4g03290.1 68417.m00449 calcium-binding protein, putative simil... 50 1e-07 At3g59440.1 68416.m06630 calcium-binding protein, putative simil... 50 1e-07 At2g36180.1 68415.m04440 calmodulin-related protein, putative si... 50 2e-07 At1g66400.1 68414.m07541 calmodulin-related protein, putative si... 50 2e-07 At1g18210.2 68414.m02267 calcium-binding protein, putative simil... 50 2e-07 At1g18210.1 68414.m02266 calcium-binding protein, putative simil... 50 2e-07 At3g10660.1 68416.m01282 calcium-dependent protein kinase isofor... 50 2e-07 At4g09570.1 68417.m01575 calcium-dependent protein kinase, putat... 49 4e-07 At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDP... 49 4e-07 At4g37010.1 68417.m05243 caltractin, putative / centrin, putativ... 48 8e-07 At4g23650.1 68417.m03405 calcium-dependent protein kinase, putat... 48 8e-07 At3g25600.1 68416.m03187 calmodulin, putative similar to calmodu... 48 8e-07 At4g21940.1 68417.m03174 calcium-dependent protein kinase, putat... 47 1e-06 At4g38230.1 68417.m05399 calcium-dependent protein kinase, putat... 47 2e-06 At4g12860.1 68417.m02014 calcium-binding protein, putative simil... 47 2e-06 At1g18530.1 68414.m02312 calmodulin, putative similar to calmodu... 47 2e-06 At4g35310.1 68417.m05019 calcium-dependent protein kinase, putat... 46 2e-06 At1g76040.2 68414.m08829 calcium-dependent protein kinase, putat... 46 2e-06 At1g76040.1 68414.m08830 calcium-dependent protein kinase, putat... 46 2e-06 At4g04695.1 68417.m00689 calcium-dependent protein kinase, putat... 46 4e-06 At4g04720.1 68417.m00693 calcium-dependent protein kinase, putat... 45 5e-06 At3g50770.1 68416.m05560 calmodulin-related protein, putative si... 45 5e-06 At1g61950.1 68414.m06988 calcium-dependent protein kinase, putat... 45 7e-06 At3g20410.1 68416.m02585 calmodulin-domain protein kinase isofor... 44 9e-06 At3g10190.1 68416.m01220 calmodulin, putative similar to calmodu... 44 9e-06 At1g50700.1 68414.m05701 calcium-dependent protein kinase, putat... 44 9e-06 At3g07490.1 68416.m00893 calcium-binding protein, putative simil... 44 2e-05 At2g17290.1 68415.m01997 calcium-dependent protein kinase isofor... 44 2e-05 At5g19360.1 68418.m02307 calcium-dependent protein kinase, putat... 43 2e-05 At5g12180.1 68418.m01429 calcium-dependent protein kinase, putat... 43 2e-05 At4g04700.1 68417.m00690 calcium-dependent protein kinase, putat... 43 3e-05 At2g38910.1 68415.m04783 calcium-dependent protein kinase, putat... 43 3e-05 At4g04710.1 68417.m00692 calcium-dependent protein kinase, putat... 42 4e-05 At1g74740.1 68414.m08660 calcium-dependent protein kinase, putat... 41 9e-05 At3g03430.1 68416.m00341 polcalcin, putative / calcium-binding p... 41 1e-04 At3g03400.1 68416.m00337 calmodulin-related protein, putative si... 40 2e-04 At4g20780.1 68417.m03017 calcium-binding protein, putative simil... 40 3e-04 At5g44460.1 68418.m05448 calcium-binding protein, putative simil... 39 4e-04 At4g04740.1 68417.m00695 calcium-dependent protein kinase, putat... 39 4e-04 At3g51850.1 68416.m05686 calcium-dependent protein kinase, putat... 39 4e-04 At1g18890.1 68414.m02351 calcium-dependent protein kinase 1 (CDP... 39 4e-04 At5g12480.1 68418.m01466 calmodulin-domain protein kinase isofor... 38 6e-04 At2g15680.1 68415.m01795 calmodulin-related protein, putative si... 38 6e-04 At5g19450.2 68418.m02318 calcium-dependent protein kinase 19 (CD... 38 8e-04 At5g19450.1 68418.m02317 calcium-dependent protein kinase 19 (CD... 38 8e-04 At2g31500.1 68415.m03848 calcium-dependent protein kinase, putat... 38 8e-04 At3g03410.1 68416.m00339 calmodulin-related protein, putative si... 37 0.001 At5g49480.1 68418.m06123 sodium-inducible calcium-binding protei... 37 0.002 At1g76650.1 68414.m08919 calcium-binding EF hand family protein ... 37 0.002 At5g17480.1 68418.m02051 polcalcin, putative / calcium-binding p... 36 0.002 At2g45670.1 68415.m05678 calcineurin B subunit-related contains ... 36 0.002 At2g41860.2 68415.m05174 calcium-dependent protein kinase, putat... 36 0.003 At2g41860.1 68415.m05173 calcium-dependent protein kinase, putat... 36 0.003 At1g76640.1 68414.m08918 calmodulin-related protein, putative si... 36 0.004 At2g41410.1 68415.m05110 calmodulin, putative identical to SP|P3... 35 0.006 At2g35890.1 68415.m04406 calcium-dependent protein kinase, putat... 35 0.006 At1g73440.1 68414.m08501 calmodulin-related low similarity to ca... 35 0.006 At3g17470.1 68416.m02232 RelA/SpoT domain-containing protein / c... 34 0.013 At3g57530.1 68416.m06406 calcium-dependent protein kinase, putat... 33 0.018 At3g47480.1 68416.m05163 calcium-binding EF hand family protein ... 33 0.018 At5g42380.1 68418.m05160 calmodulin-related protein, putative si... 31 0.071 At3g29000.1 68416.m03624 calcium-binding EF hand family protein ... 31 0.071 At3g05310.1 68416.m00579 GTP-binding protein-related low similar... 31 0.071 At3g10300.3 68416.m01236 calcium-binding EF hand family protein ... 31 0.093 At3g10300.2 68416.m01235 calcium-binding EF hand family protein ... 31 0.093 At3g56760.1 68416.m06313 calcium-dependent protein kinase, putat... 31 0.12 At1g21550.1 68414.m02695 calcium-binding protein, putative conta... 31 0.12 At5g39670.1 68418.m04804 calcium-binding EF hand family protein ... 30 0.22 At4g26470.1 68417.m03808 calcium-binding EF hand family protein ... 30 0.22 At2g41140.1 68415.m05081 calcium-dependent protein kinase, putat... 30 0.22 At3g24110.1 68416.m03027 calcium-binding EF hand family protein ... 29 0.38 At1g49580.1 68414.m05559 calcium-dependent protein kinase, putat... 29 0.38 At2g46700.1 68415.m05827 calcium-dependent protein kinase, putat... 28 0.66 At1g23240.2 68414.m02908 caleosin-related family protein similar... 28 0.66 At4g32060.1 68417.m04563 calcium-binding EF hand family protein ... 28 0.87 At3g20290.1 68416.m02571 calcium-binding EF hand family protein ... 28 0.87 At5g47910.1 68418.m05918 respiratory burst oxidase protein D (Rb... 27 1.1 At2g35800.1 68415.m04396 mitochondrial substrate carrier family ... 27 1.1 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 27 1.1 At1g06570.1 68414.m00696 4-hydroxyphenylpyruvate dioxygenase (HP... 27 1.1 At3g63150.1 68416.m07092 GTP-binding protein-related low similar... 27 1.5 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 27 2.0 At3g45810.1 68416.m04958 ferric reductase-like transmembrane com... 27 2.0 At5g29560.1 68418.m03629 Ca+2-binding EF hand family protein con... 26 2.7 At4g21490.1 68417.m03107 pyridine nucleotide-disulphide oxidored... 26 2.7 At4g00140.1 68417.m00014 expressed protein 26 2.7 At3g57140.2 68416.m06362 patatin-related contains Patatin domain... 26 2.7 At3g57140.1 68416.m06361 patatin-related contains Patatin domain... 26 2.7 At3g50530.1 68416.m05526 calcium-dependent protein kinase, putat... 26 2.7 At5g04170.1 68418.m00405 calcium-binding EF hand family protein ... 26 3.5 At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-r... 26 3.5 At5g27540.1 68418.m03297 GTP-binding protein-related low similar... 25 4.6 At5g04040.1 68418.m00384 patatin-related contains Patatin domain... 25 4.6 At3g03240.1 68416.m00320 esterase/lipase/thioesterase family pro... 25 4.6 At1g73390.3 68414.m08497 expressed protein 25 4.6 At1g73390.2 68414.m08496 expressed protein 25 4.6 At1g73390.1 68414.m08495 expressed protein 25 4.6 At5g51060.1 68418.m06329 respiratory burst oxidase protein C (Rb... 25 6.1 At5g17180.1 68418.m02013 hypothetical protein 25 6.1 At4g25090.1 68417.m03604 respiratory burst oxidase, putative / N... 25 6.1 At4g05020.1 68417.m00736 NADH dehydrogenase-related similar to a... 25 6.1 At3g09600.1 68416.m01140 myb family transcription factor contain... 25 6.1 At3g03230.1 68416.m00319 esterase/lipase/thioesterase family pro... 25 6.1 At5g60010.1 68418.m07525 ferric reductase-like transmembrane com... 25 8.1 At4g28510.1 68417.m04078 prohibitin, putative similar to SP|P241... 25 8.1 At3g18430.1 68416.m02343 calcium-binding EF hand family protein ... 25 8.1 At3g12210.2 68416.m01524 expressed protein 25 8.1 At3g12210.1 68416.m01523 expressed protein 25 8.1 >At5g37780.1 68418.m04549 calmodulin-1/4 (CAM1) identical to calmodulin 4 [Arabidopsis thaliana] GI:16223, SP|P25854 Calmodulin-1/4 {Arabidopsis thaliana} Length = 149 Score = 116 bits (279), Expect = 2e-27 Identities = 55/58 (94%), Positives = 57/58 (98%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ADQLT+EQI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 2 ADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59 Score = 53.2 bits (122), Expect = 2e-08 Identities = 26/61 (42%), Positives = 37/61 (60%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA + E KEAF +FDKD +G I+ EL VM +LG+ T+ E+++MI E D Sbjct: 72 LMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADV 131 Query: 63 D 63 D Sbjct: 132 D 132 Score = 27.9 bits (59), Expect = 0.87 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKE-LGTVMRSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E L + + + +E EL++ D D Sbjct: 47 AELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKD 96 >At1g66410.1 68414.m07542 calmodulin-1/4 (CAM4) identical to calmodulin [Arabidopsis thaliana] GI:16223; nearly identical to SP|P25854 Calmodulin-1/4 {Arabidopsis thaliana} Length = 149 Score = 116 bits (279), Expect = 2e-27 Identities = 55/58 (94%), Positives = 57/58 (98%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ADQLT+EQI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 2 ADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59 Score = 53.2 bits (122), Expect = 2e-08 Identities = 26/61 (42%), Positives = 37/61 (60%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA + E KEAF +FDKD +G I+ EL VM +LG+ T+ E+++MI E D Sbjct: 72 LMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADV 131 Query: 63 D 63 D Sbjct: 132 D 132 Score = 27.9 bits (59), Expect = 0.87 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKE-LGTVMRSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E L + + + +E EL++ D D Sbjct: 47 AELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKD 96 >At5g21274.1 68418.m02533 calmodulin-6 (CAM6) identical to calmodulin-6 SP:Q03509 from [Arabidopsis thaliana]; contains Pfam profile: PF00036 EF hand Length = 149 Score = 115 bits (276), Expect = 4e-27 Identities = 54/58 (93%), Positives = 57/58 (98%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ADQLT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 2 ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59 Score = 50.8 bits (116), Expect = 1e-07 Identities = 25/61 (40%), Positives = 36/61 (59%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA + E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D Sbjct: 72 LMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDEEVDEMIREADV 131 Query: 63 D 63 D Sbjct: 132 D 132 Score = 29.1 bits (62), Expect = 0.38 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKE-LGTVMRSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E L + R + +E EL++ D D Sbjct: 47 AELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD 96 >At3g56800.1 68416.m06317 calmodulin-2/3/5 (CAM3) identical to calmodulin GI:474183 from [Arabidopsis thaliana]; almost identical to calmodulin-2/3/5 SP:P25069 [Arabidopsis thaliana] Length = 149 Score = 115 bits (276), Expect = 4e-27 Identities = 54/58 (93%), Positives = 57/58 (98%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ADQLT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 2 ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59 Score = 52.4 bits (120), Expect = 4e-08 Identities = 26/61 (42%), Positives = 36/61 (59%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA + E KEAF +FDKD +G I+ EL VM +LG+ T+ E+ +MI E D Sbjct: 72 LMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADV 131 Query: 63 D 63 D Sbjct: 132 D 132 Score = 29.1 bits (62), Expect = 0.38 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKE-LGTVMRSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E L + R + +E EL++ D D Sbjct: 47 AELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD 96 >At3g43810.1 68416.m04682 calmodulin-7 (CAM7) almost identical to calmodulin GI:16227 from [Arabidopsis thaliana], SP|P59220 Calmodulin-7 {Arabidopsis thaliana} Length = 149 Score = 115 bits (276), Expect = 4e-27 Identities = 54/58 (93%), Positives = 57/58 (98%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ADQLT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 2 ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59 Score = 52.4 bits (120), Expect = 4e-08 Identities = 26/61 (42%), Positives = 36/61 (59%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA + E KEAF +FDKD +G I+ EL VM +LG+ T+ E+ +MI E D Sbjct: 72 LMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADV 131 Query: 63 D 63 D Sbjct: 132 D 132 Score = 29.1 bits (62), Expect = 0.38 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKE-LGTVMRSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E L + R + +E EL++ D D Sbjct: 47 AELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD 96 >At2g41110.1 68415.m05078 calmodulin-2/3/5 (CAM2) (CAL1) almost identical to Calmodulin-2/3/5 SP:P25069 from [Arabidopsis thaliana] Length = 149 Score = 115 bits (276), Expect = 4e-27 Identities = 54/58 (93%), Positives = 57/58 (98%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ADQLT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 2 ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59 Score = 52.4 bits (120), Expect = 4e-08 Identities = 26/61 (42%), Positives = 36/61 (59%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA + E KEAF +FDKD +G I+ EL VM +LG+ T+ E+ +MI E D Sbjct: 72 LMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADV 131 Query: 63 D 63 D Sbjct: 132 D 132 Score = 29.1 bits (62), Expect = 0.38 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKE-LGTVMRSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E L + R + +E EL++ D D Sbjct: 47 AELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD 96 >At2g27030.3 68415.m03247 calmodulin-2/3/5 (CAM5) (TCH1) identical to calmodulin GI:474183 from [Arabidopsis thaliana], SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana} Length = 181 Score = 115 bits (276), Expect = 4e-27 Identities = 54/58 (93%), Positives = 57/58 (98%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ADQLT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 2 ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59 Score = 52.4 bits (120), Expect = 4e-08 Identities = 26/61 (42%), Positives = 36/61 (59%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA + E KEAF +FDKD +G I+ EL VM +LG+ T+ E+ +MI E D Sbjct: 72 LMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADV 131 Query: 63 D 63 D Sbjct: 132 D 132 Score = 29.1 bits (62), Expect = 0.38 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKE-LGTVMRSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E L + R + +E EL++ D D Sbjct: 47 AELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD 96 >At2g27030.1 68415.m03245 calmodulin-2/3/5 (CAM5) (TCH1) identical to calmodulin GI:474183 from [Arabidopsis thaliana], SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana} Length = 149 Score = 115 bits (276), Expect = 4e-27 Identities = 54/58 (93%), Positives = 57/58 (98%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ADQLT++QI+EFKEAFSLFDKDGDG ITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 2 ADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59 Score = 52.4 bits (120), Expect = 4e-08 Identities = 26/61 (42%), Positives = 36/61 (59%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA + E KEAF +FDKD +G I+ EL VM +LG+ T+ E+ +MI E D Sbjct: 72 LMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADV 131 Query: 63 D 63 D Sbjct: 132 D 132 Score = 29.1 bits (62), Expect = 0.38 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKE-LGTVMRSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E L + R + +E EL++ D D Sbjct: 47 AELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD 96 >At3g22930.1 68416.m02889 calmodulin, putative strong similarity to calmodulin 8 GI:5825600 from [Arabidopsis thaliana]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 173 Score = 91.1 bits (216), Expect = 8e-20 Identities = 42/56 (75%), Positives = 47/56 (83%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +LT+EQI EFKEAF LFDKDGDG IT EL TV+RSL QNPTE ELQDMI E+D+D Sbjct: 27 ELTQEQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEIDSD 82 Score = 52.4 bits (120), Expect = 4e-08 Identities = 28/61 (45%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 4 MAADQLTEEQI-AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 + A+QL E E KEAF +FDKD +G I+ EL VM +LG+ T+ E+ MI E D Sbjct: 95 LMANQLQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQMIKEADL 154 Query: 63 D 63 D Sbjct: 155 D 155 Score = 30.3 bits (65), Expect = 0.16 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Query: 2 VVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKE-LGTVMRSLGQNPTEAELQDMINEV 60 V+ + DQ EQ E ++ + D DG+GTI E L + L + + EL++ Sbjct: 59 VIRSLDQNPTEQ--ELQDMITEIDSDGNGTIEFSEFLNLMANQLQETDADEELKEAFKVF 116 Query: 61 DAD 63 D D Sbjct: 117 DKD 119 >At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-related protein 3, touch-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] Length = 235 Score = 89.4 bits (212), Expect = 3e-19 Identities = 37/58 (63%), Positives = 52/58 (89%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AD+LT++QI E++E+F LFDK+GDG+IT KELGT+MRS+G+ PT+A+LQD++NE D D Sbjct: 2 ADKLTDDQITEYRESFRLFDKNGDGSITKKELGTMMRSIGEKPTKADLQDLMNEADLD 59 Score = 84.6 bits (200), Expect = 7e-18 Identities = 39/56 (69%), Positives = 46/56 (82%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 QLT++QI EF+EAF +FDK+GDG IT EL T MRSLG+ T+AELQDMINE DAD Sbjct: 94 QLTDDQILEFREAFRVFDKNGDGYITVNELRTTMRSLGETQTKAELQDMINEADAD 149 Score = 25.8 bits (54), Expect = 3.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVM 41 AE ++ + D DGDGTI+ E VM Sbjct: 137 AELQDMINEADADGDGTISFSEFVCVM 163 >At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] Length = 324 Score = 89.4 bits (212), Expect = 3e-19 Identities = 37/58 (63%), Positives = 52/58 (89%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AD+LT++QI E++E+F LFDK+GDG+IT KELGT+MRS+G+ PT+A+LQD++NE D D Sbjct: 2 ADKLTDDQITEYRESFRLFDKNGDGSITKKELGTMMRSIGEKPTKADLQDLMNEADLD 59 Score = 86.2 bits (204), Expect = 2e-18 Identities = 39/58 (67%), Positives = 51/58 (87%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AD+LT++QI E++E+F LFDK+GDG+IT KEL TVM SLG+N T+A+LQDM+NEVD D Sbjct: 91 ADKLTDDQITEYRESFRLFDKNGDGSITKKELRTVMFSLGKNRTKADLQDMMNEVDLD 148 Score = 84.6 bits (200), Expect = 7e-18 Identities = 39/56 (69%), Positives = 46/56 (82%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 QLT++QI EF+EAF +FDK+GDG IT EL T MRSLG+ T+AELQDMINE DAD Sbjct: 183 QLTDDQILEFREAFRVFDKNGDGYITVNELRTTMRSLGETQTKAELQDMINEADAD 238 Score = 25.8 bits (54), Expect = 3.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVM 41 AE ++ + D DGDGTI+ E VM Sbjct: 226 AELQDMINEADADGDGTISFSEFVCVM 252 >At4g14640.1 68417.m02252 calmodulin-8 (CAM8) identical to calmodulin 8 GI:5825600 from [Arabidopsis thaliana] Length = 151 Score = 87.0 bits (206), Expect = 1e-18 Identities = 40/61 (65%), Positives = 48/61 (78%) Query: 4 MAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 M LT++QI EFKEAF LFDKDGDG IT +EL TV+RSL QNPTE EL D+I E+D+D Sbjct: 1 MEETALTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSD 60 Query: 64 A 64 + Sbjct: 61 S 61 Score = 52.0 bits (119), Expect = 5e-08 Identities = 24/48 (50%), Positives = 32/48 (66%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E KEAF +FDKD +G I+ EL VM +LG+ T+ E++ MI E D D Sbjct: 86 ELKEAFKVFDKDQNGYISASELSHVMINLGEKLTDEEVEQMIKEADLD 133 >At2g41090.1 68415.m05075 calmodulin-like calcium-binding protein, 22 kDa (CaBP-22) identical to SP|P30187 22 kDa calmodulin-like calcium-binding protein (CABP-22) [Arabidopsis thaliana] Length = 191 Score = 77.8 bits (183), Expect = 8e-16 Identities = 35/58 (60%), Positives = 47/58 (81%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A++ T +QI+EF+E FS++DK+GDG ITT+E G VMRSLG N T+AELQ+ IN+ D D Sbjct: 2 ANKFTRQQISEFREQFSVYDKNGDGHITTEEFGAVMRSLGLNLTQAELQEEINDSDLD 59 Score = 34.3 bits (75), Expect = 0.010 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Query: 1 MVVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV 60 + MA D +E+ + K+ F LFD D +G I+ E+ V L T+ E+ ++I Sbjct: 70 LCAMAKDTYSEKDL---KKDFRLFDIDKNGFISAAEMRYVRTILRWKQTDEEIDEIIKAA 126 Query: 61 DAD 63 D D Sbjct: 127 DVD 129 >At1g12310.1 68414.m01423 calmodulin, putative similar to calmodulin SP:P04465 from [Trypanosoma brucei gambiense] Length = 148 Score = 68.1 bits (159), Expect = 7e-13 Identities = 30/54 (55%), Positives = 40/54 (74%) Query: 4 MAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI 57 M D L+++Q++ KEAF LFD DGDG I ELG +MRSLG NPT+A+L+ +I Sbjct: 1 MGKDGLSDDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTQAQLKSII 54 Score = 41.9 bits (94), Expect = 5e-05 Identities = 21/68 (30%), Positives = 35/68 (51%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA TE + ++AF + DK+G G + +L ++ S+G+ E + I EVD Sbjct: 71 LMAKHLKTEPFDRQLRDAFKVLDKEGTGFVAVADLRHILTSIGEKLEPNEFDEWIKEVDV 130 Query: 63 DAYEKWRY 70 + K RY Sbjct: 131 GSDGKIRY 138 >At3g51920.1 68416.m05695 calmodulin-9 (CAM9) identical to calmodulin 9 GI:5825602 from [Arabidopsis thaliana]; contains Pfam profile PF00036: EF hand Length = 151 Score = 67.7 bits (158), Expect = 9e-13 Identities = 31/56 (55%), Positives = 41/56 (73%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 AD T+EQI EF EAF L DKD DG IT ++L VM+S+G+NP +LQ M+++VD Sbjct: 2 ADAFTDEQIQEFYEAFCLIDKDSDGFITKEKLTKVMKSMGKNPKAEQLQQMMSDVD 57 Score = 50.8 bits (116), Expect = 1e-07 Identities = 24/63 (38%), Positives = 34/63 (53%) Query: 1 MVVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV 60 + +MA + E E E F +FD+DGDG I+ ELG M+ +G T E + M+ E Sbjct: 70 LYIMAQNTSQESASDELIEVFRVFDRDGDGLISQLELGEGMKDMGMKITAEEAEHMVREA 129 Query: 61 DAD 63 D D Sbjct: 130 DLD 132 >At1g62820.1 68414.m07092 calmodulin, putative similar to calmodulin SP:P04465 from [Trypanosoma brucei gambiense]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 148 Score = 67.7 bits (158), Expect = 9e-13 Identities = 30/54 (55%), Positives = 40/54 (74%) Query: 4 MAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI 57 M+ D L+ +Q++ KEAF LFD DGDG I ELG +MRSLG NPTE++L+ +I Sbjct: 1 MSKDGLSNDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTESQLKSII 54 Score = 43.2 bits (97), Expect = 2e-05 Identities = 21/68 (30%), Positives = 36/68 (52%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA TE + ++AF + DK+G G + +L ++ S+G+ +E + I EVD Sbjct: 71 LMAKHLKTEPFDRQLRDAFKVLDKEGTGFVAVADLRHILTSIGEKLQPSEFDEWIKEVDV 130 Query: 63 DAYEKWRY 70 + K RY Sbjct: 131 GSDGKIRY 138 >At3g50360.1 68416.m05507 caltractin / centrin identical to caltractin; centrin GI:3688162 from [Arabidopsis thaliana] Length = 169 Score = 60.1 bits (139), Expect = 2e-10 Identities = 29/55 (52%), Positives = 35/55 (63%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 LT ++ E KEAF LFD DG GTI KEL MR+LG TE ++ MI +VD D Sbjct: 20 LTTQKKQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQINKMIADVDKD 74 Score = 42.7 bits (96), Expect = 3e-05 Identities = 17/48 (35%), Positives = 31/48 (64%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E +AF + D D +G I+ ++ + + LG+N T+AE+++M+ E D D Sbjct: 100 ELTKAFQIIDLDKNGKISPDDIKRMAKDLGENFTDAEIREMVEEADRD 147 >At3g03000.1 68416.m00295 calmodulin, putative similar to calmodulin SP:P04352 from [Chlamydomonas reinhardtii]; contains Pfam profile: PF00036 EF hand (4 copies) Length = 165 Score = 55.2 bits (127), Expect = 5e-09 Identities = 24/57 (42%), Positives = 40/57 (70%) Query: 5 AADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 A +L +EQ+AE +E F FD++ DG++T ELG+++RSLG P++ +L +I + D Sbjct: 9 APAKLGDEQLAELREIFRSFDQNKDGSLTELELGSLLRSLGLKPSQDQLDTLIQKAD 65 Score = 44.4 bits (100), Expect = 9e-06 Identities = 22/48 (45%), Positives = 26/48 (54%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + K F +FD+DG+G IT EL M LG T EL MI E D D Sbjct: 94 QLKAIFRMFDRDGNGYITAAELAHSMAKLGHALTAEELTGMIKEADRD 141 >At5g23580.1 68418.m02767 calcium-dependent protein kinase 9 (CDPK9) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836938|gb|AAA67653; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 490 Score = 53.2 bits (122), Expect = 2e-08 Identities = 24/58 (41%), Positives = 36/58 (62%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A++L+EE+I KE F + D D GTIT +EL MR +G E+E+Q+++ D D Sbjct: 317 AERLSEEEIGGLKELFKMIDTDKSGTITFEELKDSMRRVGSELMESEIQELLRAADVD 374 Score = 39.1 bits (87), Expect = 4e-04 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AFS FDKD G IT +EL + G N ++ L +MI ++D D Sbjct: 403 AFSFFDKDASGYITIEELQQAWKEFGIN--DSNLDEMIKDIDQD 444 >At2g27030.2 68415.m03246 calmodulin-2/3/5 (CAM5) (TCH1) identical to calmodulin GI:474183 from [Arabidopsis thaliana], SP|P25069 Calmodulin-2/3/5 {Arabidopsis thaliana} Length = 113 Score = 52.4 bits (120), Expect = 4e-08 Identities = 26/61 (42%), Positives = 36/61 (59%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA + E KEAF +FDKD +G I+ EL VM +LG+ T+ E+ +MI E D Sbjct: 36 LMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADV 95 Query: 63 D 63 D Sbjct: 96 D 96 Score = 50.8 bits (116), Expect = 1e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Query: 41 MRSLGQNPTEAELQDMINEVDAD 63 MRSLGQNPTEAELQDMINEVDAD Sbjct: 1 MRSLGQNPTEAELQDMINEVDAD 23 Score = 29.1 bits (62), Expect = 0.38 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKE-LGTVMRSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E L + R + +E EL++ D D Sbjct: 11 AELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKD 60 >At1g32250.1 68414.m03967 calmodulin, putative similar to calmodulin GB:M59770 GI:160127 from (Plasmodium falciparum); contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 166 Score = 52.4 bits (120), Expect = 4e-08 Identities = 22/54 (40%), Positives = 38/54 (70%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 +L EEQI E +E F FD++ DG++T ELG+++R+LG P+ + + +I++ D Sbjct: 8 KLDEEQINELREIFRSFDRNKDGSLTQLELGSLLRALGVKPSPDQFETLIDKAD 61 Score = 46.0 bits (104), Expect = 3e-06 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Query: 10 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 TEEQ+ F +FD DG+G IT EL M LG T AEL MI E D+D Sbjct: 92 TEEQLLRL---FRIFDTDGNGFITAAELAHSMAKLGHALTVAELTGMIKEADSD 142 >At1g05990.1 68414.m00627 calcium-binding protein, putative strong similarity to calcium-binding protein [Lotus japonicus] GI:18413495; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 150 Score = 52.4 bits (120), Expect = 4e-08 Identities = 24/48 (50%), Positives = 31/48 (64%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E K F +FDK+GDGTIT KEL +RSLG + EL MI ++D + Sbjct: 5 ELKRVFQMFDKNGDGTITGKELSETLRSLGIYIPDKELTQMIEKIDVN 52 Score = 49.2 bits (112), Expect = 3e-07 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG--QNPTEAELQDMINEVDADAYEKW 68 +E+ + KEAF++FD++GDG IT EL V+ SLG Q T + + MI +VD D + Sbjct: 74 DEEEEDMKEAFNVFDQNGDGFITVDELKAVLSSLGLKQGKTLDDCKKMIKKVDVDGDGRV 133 Query: 69 RY 70 Y Sbjct: 134 NY 135 >At5g37770.1 68418.m04547 touch-responsive protein / calmodulin-related protein 2, touch-induced (TCH2) identical to calmodulin-related protein 2,touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 161 Score = 52.0 bits (119), Expect = 5e-08 Identities = 22/50 (44%), Positives = 37/50 (74%) Query: 14 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +++ KEAF L+D DG+G I+ KEL +VM++LG+ + + + MI++VD D Sbjct: 92 VSDLKEAFELYDLDGNGRISAKELHSVMKNLGEKCSVQDCKKMISKVDID 141 Score = 39.5 bits (88), Expect = 3e-04 Identities = 18/48 (37%), Positives = 27/48 (56%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + K+ F FDK+GDG I+ EL V+R+L + E M+ + D D Sbjct: 17 DIKKVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQFDLD 64 >At2g43290.1 68415.m05382 calmodulin-like protein (MSS3) identical to calmodulin-like MSS3 from GI:9965747 [Arabidopsis thaliana] Length = 215 Score = 52.0 bits (119), Expect = 5e-08 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 4/66 (6%) Query: 7 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG--QNPTEAELQDMINEVDADA 64 D TEE+ + K+AF++FD+DGDG IT +EL +VM SLG Q T + MI +VDAD Sbjct: 136 DGETEEE--DMKDAFNVFDQDGDGFITVEELKSVMASLGLKQGKTLDGCKKMIMQVDADG 193 Query: 65 YEKWRY 70 + Y Sbjct: 194 DGRVNY 199 Score = 46.0 bits (104), Expect = 3e-06 Identities = 20/49 (40%), Positives = 32/49 (65%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +E K F +FDK+GDG IT +EL + +LG + +L MI+++DA+ Sbjct: 64 SELKRVFQMFDKNGDGRITKEELNDSLENLGIYIPDKDLTQMIHKIDAN 112 >At1g73630.1 68414.m08524 calcium-binding protein, putative similar to calcium binding protein GI:14589311 from [Sesbania rostrata]; contains Pfam profile: PF00036 EF hand (4 copies) Length = 163 Score = 51.6 bits (118), Expect = 6e-08 Identities = 22/48 (45%), Positives = 32/48 (66%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E K+ F FD +GDG I+ ELG V +S+G + TE EL +++E+D D Sbjct: 20 ELKKVFDKFDANGDGKISVSELGNVFKSMGTSYTEEELNRVLDEIDID 67 Score = 37.5 bits (83), Expect = 0.001 Identities = 17/48 (35%), Positives = 28/48 (58%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E +EAF L+D++ +G I++ E+ V+ LG + + MI VD D Sbjct: 89 EIREAFDLYDQNKNGLISSSEIHKVLNRLGMTCSVEDCVRMIGHVDTD 136 >At1g24620.1 68414.m03097 polcalcin, putative / calcium-binding pollen allergen, putative similar to polcalcin Jun o 2 (calcium-binding pollen allergen Jun o 2) SP:O64943 from [Juniperus oxycedrus] Length = 186 Score = 51.2 bits (117), Expect = 8e-08 Identities = 23/49 (46%), Positives = 31/49 (63%) Query: 13 QIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 +I E + F FD +GDG I++KELG +M SLG E EL+ I E+D Sbjct: 34 EIRELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVPEEELEKAITEID 82 Score = 48.8 bits (111), Expect = 4e-07 Identities = 23/50 (46%), Positives = 34/50 (68%) Query: 14 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + K+AFS++D DG+G+I+ +EL V+RSLG + AE + MI VD D Sbjct: 108 LENLKDAFSVYDIDGNGSISAEELHEVLRSLGDECSIAECRKMIGGVDKD 157 Score = 28.3 bits (60), Expect = 0.66 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG 45 E IAE ++ DKDGDGTI +E +M ++G Sbjct: 141 ECSIAECRKMIGGVDKDGDGTIDFEEF-KIMMTMG 174 >At5g17470.1 68418.m02050 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 146 Score = 50.8 bits (116), Expect = 1e-07 Identities = 24/53 (45%), Positives = 33/53 (62%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E++ KEAF L+D DGDG I+ E+ V++ LG+ T AE M+ VDAD Sbjct: 72 EDEDIVMKEAFDLYDIDGDGKISASEIHVVLKRLGEKQTIAECIAMVRAVDAD 124 Score = 34.3 bits (75), Expect = 0.010 Identities = 15/45 (33%), Positives = 23/45 (51%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E F DK+ DG I+ E +R+ + T E+ +M E+D D Sbjct: 5 EIFERVDKNKDGKISWDEFAEAIRAFSPSITSEEIDNMFREIDVD 49 >At5g04870.1 68418.m00510 calcium-dependent protein kinase isoform AK1 (AK1) identical to calcium-dependent protein kinase, isoform AK1 (CDPK) [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 610 Score = 50.4 bits (115), Expect = 1e-07 Identities = 23/58 (39%), Positives = 36/58 (62%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+EE+IA KE F++ D D G IT +EL ++ +G N E+E+ D++ D D Sbjct: 445 AESLSEEEIAGLKEMFNMIDADKSGQITFEELKAGLKRVGANLKESEILDLMQAADVD 502 Score = 33.9 bits (74), Expect = 0.013 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AF+ FDKDG G IT EL G + +++++ +VD D Sbjct: 531 AFTYFDKDGSGYITPDELQQACEEFGVE--DVRIEELMRDVDQD 572 >At4g03290.1 68417.m00449 calcium-binding protein, putative similar to calcium-binding protein [Lotus japonicus] GI:18413495; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 154 Score = 50.4 bits (115), Expect = 1e-07 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 5/73 (6%) Query: 1 MVVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG--QNPTEAELQDMIN 58 ++V D++ EE + KEAF++FD++GDG IT EL V+ SLG Q T E + MI Sbjct: 69 IMVEDEDEVGEE---DMKEAFNVFDRNGDGFITVDELKAVLSSLGLKQGKTLEECRKMIM 125 Query: 59 EVDADAYEKWRYI 71 +VD D + Y+ Sbjct: 126 QVDVDGDGRVNYM 138 Score = 47.6 bits (108), Expect = 1e-06 Identities = 22/48 (45%), Positives = 29/48 (60%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E F +FDKDGDG ITTKEL ++LG E EL +I ++D + Sbjct: 5 ELNRVFQMFDKDGDGKITTKELNESFKNLGIIIPEDELTQIIQKIDVN 52 >At3g59440.1 68416.m06630 calcium-binding protein, putative similar to calcium-binding protein [Lotus japonicus] GI:18413495 Length = 195 Score = 50.4 bits (115), Expect = 1e-07 Identities = 26/62 (41%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG--QNPTEAELQDMINEVDADAYEKW 68 E++ + ++AF++FD+DGDG IT +EL +VM SLG Q T ++MI +VD D + Sbjct: 118 EKEEGDMRDAFNVFDQDGDGFITVEELNSVMTSLGLKQGKTLECCKEMIMQVDEDGDGRV 177 Query: 69 RY 70 Y Sbjct: 178 NY 179 Score = 44.8 bits (101), Expect = 7e-06 Identities = 21/57 (36%), Positives = 33/57 (57%) Query: 7 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 D+ E + K F +FDK+GDG IT +EL + +LG + +L MI ++DA+ Sbjct: 42 DESETESPVDLKRVFQMFDKNGDGRITKEELNDSLENLGIFMPDKDLIQMIQKMDAN 98 Score = 27.5 bits (58), Expect = 1.1 Identities = 11/39 (28%), Positives = 20/39 (51%) Query: 25 DKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 D +GDG + E ++ S+ + E +++D N D D Sbjct: 96 DANGDGCVDINEFESLYGSIVEEKEEGDMRDAFNVFDQD 134 Score = 25.4 bits (53), Expect = 4.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRS 43 KE D+DGDG + KE +M+S Sbjct: 163 KEMIMQVDEDGDGRVNYKEFLQMMKS 188 >At2g36180.1 68415.m04440 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 144 Score = 50.0 bits (114), Expect = 2e-07 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Query: 1 MVVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV 60 MV ++ TEE++ KEAF L+D DGDG I+ E+ V++ LG+ T + M+ V Sbjct: 62 MVNGGGEKDTEEEVV-MKEAFDLYDMDGDGKISASEIHVVLKRLGEKHTMEDCVVMVQTV 120 Query: 61 DADA 64 D D+ Sbjct: 121 DKDS 124 Score = 26.2 bits (55), Expect = 2.7 Identities = 14/45 (31%), Positives = 18/45 (40%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E F DK+ DG I E +R T E+ M +D D Sbjct: 3 EIFESVDKNKDGKILWDEFAEAIRVFSPQITSEEIDKMFIVLDVD 47 >At1g66400.1 68414.m07541 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced from SP:P25070 [Arabidopsis thaliana]; contains Pfam profile: PF00036 EF hand (4 copies) Length = 157 Score = 50.0 bits (114), Expect = 2e-07 Identities = 23/50 (46%), Positives = 35/50 (70%) Query: 14 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 I + KEAF L+D D +G I+ EL +VM++LG+ + + Q MIN+VD+D Sbjct: 88 IRDLKEAFDLYDLDRNGRISANELHSVMKNLGEKCSIQDCQRMINKVDSD 137 Score = 39.5 bits (88), Expect = 3e-04 Identities = 18/48 (37%), Positives = 28/48 (58%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + K+ F FDK+ DG I+ EL V+ +L N ++ E + M+ E D D Sbjct: 15 DIKKVFQRFDKNNDGKISIDELKDVIGALSPNASQEETKAMMKEFDLD 62 >At1g18210.2 68414.m02267 calcium-binding protein, putative similar to SP|Q9M7R0 Calcium-binding allergen Ole e 8 (PCA18/PCA23) {Olea europaea}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 170 Score = 50.0 bits (114), Expect = 2e-07 Identities = 22/48 (45%), Positives = 31/48 (64%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E K+ F FD +GDG I+ ELG V +++G + TE EL ++ EVD D Sbjct: 23 ELKKVFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEEVDTD 70 Score = 42.3 bits (95), Expect = 4e-05 Identities = 20/49 (40%), Positives = 30/49 (61%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AE ++AF L+D+D +G I+ EL V+ LG + + + MI VDAD Sbjct: 91 AEIRDAFDLYDQDKNGLISASELHQVLNRLGMSCSVEDCTRMIGPVDAD 139 >At1g18210.1 68414.m02266 calcium-binding protein, putative similar to SP|Q9M7R0 Calcium-binding allergen Ole e 8 (PCA18/PCA23) {Olea europaea}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 170 Score = 50.0 bits (114), Expect = 2e-07 Identities = 22/48 (45%), Positives = 31/48 (64%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E K+ F FD +GDG I+ ELG V +++G + TE EL ++ EVD D Sbjct: 23 ELKKVFDQFDSNGDGKISVLELGGVFKAMGTSYTETELNRVLEEVDTD 70 Score = 42.3 bits (95), Expect = 4e-05 Identities = 20/49 (40%), Positives = 30/49 (61%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AE ++AF L+D+D +G I+ EL V+ LG + + + MI VDAD Sbjct: 91 AEIRDAFDLYDQDKNGLISASELHQVLNRLGMSCSVEDCTRMIGPVDAD 139 >At3g10660.1 68416.m01282 calcium-dependent protein kinase isoform 2 (CPK2) identical to calcium-dependent protein kinase isoform 2 [Arabidopsis thaliana] gi|9837343|gb|AAG00535; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 646 Score = 49.6 bits (113), Expect = 2e-07 Identities = 22/58 (37%), Positives = 35/58 (60%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+EE+IA K+ F + D D G IT +EL ++ +G N E+E+ D++ D D Sbjct: 481 AESLSEEEIAGLKQMFKMIDADNSGQITFEELKAGLKRVGANLKESEILDLMQAADVD 538 Score = 34.7 bits (76), Expect = 0.008 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AFS FDKD G IT EL G +A +++M+ +VD D Sbjct: 567 AFSYFDKDESGFITPDELQQACEEFGVE--DARIEEMMRDVDQD 608 >At4g09570.1 68417.m01575 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 501 Score = 48.8 bits (111), Expect = 4e-07 Identities = 21/58 (36%), Positives = 36/58 (62%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A++L+EE+I KE F + D D GTIT +EL ++ +G E+E++ +++ D D Sbjct: 320 AERLSEEEIGGLKELFKMIDTDNSGTITFEELKAGLKRVGSELMESEIKSLMDAADID 377 Score = 38.7 bits (86), Expect = 5e-04 Identities = 21/44 (47%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AFS FDKDG G IT EL G + L DMI E+D D Sbjct: 406 AFSYFDKDGSGYITIDELQQACTEFGL--CDTPLDDMIKEIDLD 447 >At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDPK2) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 495 Score = 48.8 bits (111), Expect = 4e-07 Identities = 21/58 (36%), Positives = 36/58 (62%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A++L+EE+I KE F + D D GTIT +EL ++ +G E+E++ +++ D D Sbjct: 321 AERLSEEEIGGLKELFKMIDTDNSGTITFEELKAGLKRVGSELMESEIKSLMDAADID 378 Score = 39.5 bits (88), Expect = 3e-04 Identities = 21/44 (47%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AFS FDKDG G IT EL + G + L DMI E+D D Sbjct: 407 AFSYFDKDGSGYITIDELQSACTEFGL--CDTPLDDMIKEIDLD 448 >At4g37010.1 68417.m05243 caltractin, putative / centrin, putative similar to Caltractin (Centrin) SP:P41210 from [Atriplex nummularia] Length = 167 Score = 48.0 bits (109), Expect = 8e-07 Identities = 22/53 (41%), Positives = 31/53 (58%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 LT ++ E +E F LFD DG G+I EL MRSLG ++ +++ EVD Sbjct: 20 LTNQKRREIREIFDLFDIDGSGSIDASELNVAMRSLGFEMNNQQINELMAEVD 72 Score = 45.2 bits (102), Expect = 5e-06 Identities = 17/52 (32%), Positives = 33/52 (63%) Query: 12 EQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + I E +AF + D D +G I+ +++ + + LG+N T+ ++++MI E D D Sbjct: 96 DSIDELSKAFKIIDHDNNGKISPRDIKMIAKELGENFTDNDIEEMIEEADRD 147 >At4g23650.1 68417.m03405 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 529 Score = 48.0 bits (109), Expect = 8e-07 Identities = 22/58 (37%), Positives = 34/58 (58%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+EE+I KE F D D +G +T +EL T + LG +EAE++ ++ D D Sbjct: 373 AENLSEEEIIGLKEMFKSLDTDNNGIVTLEELRTGLPKLGSKISEAEIRQLMEAADMD 430 >At3g25600.1 68416.m03187 calmodulin, putative similar to calmodulin GI:239841 from [Paramecium tetraurelia] Length = 161 Score = 48.0 bits (109), Expect = 8e-07 Identities = 22/58 (37%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Query: 4 MAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 MA+ + T+ QI + K+ F+ FD D DG++T EL ++RSLG P ++ ++N++D Sbjct: 1 MASTKPTD-QIKQLKDIFARFDMDKDGSLTQLELAALLRSLGIKPRSDQISLLLNQID 57 Score = 42.7 bits (96), Expect = 3e-05 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Query: 1 MVVMAADQLTEEQIA---EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI 57 +VV + EE + + E F FD+DG+G+IT EL M +G T EL +M+ Sbjct: 69 LVVAILPDINEEVLINQEQLMEVFRSFDRDGNGSITAAELAGSMAKMGHPLTYRELTEMM 128 Query: 58 NEVDAD 63 E D++ Sbjct: 129 TEADSN 134 >At4g21940.1 68417.m03174 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423 Length = 554 Score = 47.2 bits (107), Expect = 1e-06 Identities = 25/66 (37%), Positives = 35/66 (53%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAY 65 A+ L+EE+I K F+ D D GTIT +EL + LG TEAE++ ++ D D Sbjct: 396 AESLSEEEIKGLKTMFANMDTDKSGTITYEELKNGLAKLGSKLTEAEVKQLMEAADVDGN 455 Query: 66 EKWRYI 71 YI Sbjct: 456 GTIDYI 461 Score = 40.3 bits (90), Expect = 2e-04 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +AF FDKD G IT EL + M+ G EA ++++I EVD D Sbjct: 481 KAFQYFDKDNSGFITMDELESAMKEYGMG-DEASIKEVIAEVDTD 524 Score = 25.4 bits (53), Expect = 4.6 Identities = 12/29 (41%), Positives = 15/29 (51%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRS 43 A KE + D D DG I +E +MRS Sbjct: 512 ASIKEVIAEVDTDNDGRINYEEFCAMMRS 540 >At4g38230.1 68417.m05399 calcium-dependent protein kinase, putative / CDPK, putative calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 340 Score = 46.8 bits (106), Expect = 2e-06 Identities = 22/58 (37%), Positives = 31/58 (53%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+EE+IA KE F D D G IT EL +R G + E++D++ D D Sbjct: 175 AESLSEEEIAGLKEMFKAMDTDNSGAITFDELKAGLRRYGSTLKDTEIRDLMEAADID 232 Score = 35.9 bits (79), Expect = 0.003 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AF FDKDG G IT EL G ++ L+D+I EVD D Sbjct: 261 AFRYFDKDGSGYITIDELQHACAEQGM--SDVFLEDVIKEVDQD 302 >At4g12860.1 68417.m02014 calcium-binding protein, putative similar to calcium-binding protein GI:6580549 from [Lotus japonicus] Length = 152 Score = 46.8 bits (106), Expect = 2e-06 Identities = 23/55 (41%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG--QNPTEAELQDMINEVDAD 63 +E+ + +EAF +FD++GDG IT +EL +V+ S+G Q T + + MI++VD D Sbjct: 73 KEEEEDMREAFRVFDQNGDGFITDEELRSVLASMGLKQGRTLEDCKKMISKVDVD 127 Score = 39.9 bits (89), Expect = 2e-04 Identities = 18/48 (37%), Positives = 27/48 (56%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E F +FDK+GDG I EL +S+G E E+ +MI ++D + Sbjct: 5 ELSRVFQMFDKNGDGKIAKNELKDFFKSVGIMVPENEINEMIAKMDVN 52 Score = 26.2 bits (55), Expect = 2.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Query: 14 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLG 45 + + K+ S D DGDG + KE +MR G Sbjct: 114 LEDCKKMISKVDVDGDGMVNFKEFKQMMRGGG 145 >At1g18530.1 68414.m02312 calmodulin, putative similar to calmodulin GI:1565285 from [Toxoplasma gondii] Length = 157 Score = 46.8 bits (106), Expect = 2e-06 Identities = 19/53 (35%), Positives = 34/53 (64%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E+QI + K+ F FD D DG++T EL ++RSLG P+ ++ ++ +D++ Sbjct: 2 EDQIRQLKDIFDRFDMDADGSLTILELAALLRSLGLKPSGDQIHVLLASMDSN 54 Score = 42.3 bits (95), Expect = 4e-05 Identities = 20/45 (44%), Positives = 26/45 (57%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E F FD+DG+G I+ EL M +GQ T EL +MI E D + Sbjct: 85 EIFKSFDRDGNGFISAAELAGAMAKMGQPLTYKELTEMIKEADTN 129 >At4g35310.1 68417.m05019 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 556 Score = 46.4 bits (105), Expect = 2e-06 Identities = 21/58 (36%), Positives = 31/58 (53%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+EE+IA +E F D D G IT EL +R G + E+ D+++ D D Sbjct: 392 AESLSEEEIAGLREMFQAMDTDNSGAITFDELKAGLRKYGSTLKDTEIHDLMDAADVD 449 Score = 33.1 bits (72), Expect = 0.023 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 AF FDKDG G IT EL G + L+D+I EVD Sbjct: 478 AFQYFDKDGSGFITIDELQQACVEHGM--ADVFLEDIIKEVD 517 >At1g76040.2 68414.m08829 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum] Length = 534 Score = 46.4 bits (105), Expect = 2e-06 Identities = 22/58 (37%), Positives = 32/58 (55%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+EE+I K+ F D D GTIT EL + LG TE+E++ ++ D D Sbjct: 379 AENLSEEEIKGLKQTFKNMDTDESGTITFDELRNGLHRLGSKLTESEIKQLMEAADVD 436 Score = 37.9 bits (84), Expect = 8e-04 Identities = 20/45 (44%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 EAF FDKD G IT EL M G +A + ++IN+VD D Sbjct: 464 EAFKYFDKDRSGFITRDELKHSMTEYGMG-DDATIDEVINDVDTD 507 >At1g76040.1 68414.m08830 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum] Length = 323 Score = 46.4 bits (105), Expect = 2e-06 Identities = 22/58 (37%), Positives = 32/58 (55%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+EE+I K+ F D D GTIT EL + LG TE+E++ ++ D D Sbjct: 168 AENLSEEEIKGLKQTFKNMDTDESGTITFDELRNGLHRLGSKLTESEIKQLMEAADVD 225 Score = 37.9 bits (84), Expect = 8e-04 Identities = 20/45 (44%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 EAF FDKD G IT EL M G +A + ++IN+VD D Sbjct: 253 EAFKYFDKDRSGFITRDELKHSMTEYGMG-DDATIDEVINDVDTD 296 >At4g04695.1 68417.m00689 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Lycopersicon esculentum] gi|19171502|emb|CAC87494; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 484 Score = 45.6 bits (103), Expect = 4e-06 Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 V+AA+ L+EE+I K F+ D D GTIT +EL T + LG N ++ E++ ++ D Sbjct: 324 VIAAN-LSEEEIKGLKTLFTNIDTDKSGTITLEELKTGLTRLGSNLSKTEVEQLMEAADV 382 Query: 63 D 63 D Sbjct: 383 D 383 Score = 39.1 bits (87), Expect = 4e-04 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +AF FDKD DG IT +EL M+ G E ++ +I EVD D Sbjct: 411 QAFQHFDKDNDGHITKEELEMAMKEHGVG-DEVSIKQIITEVDTD 454 Score = 25.0 bits (52), Expect = 6.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAEL 53 K+ + D D DG I +E T+MRS + EL Sbjct: 445 KQIITEVDTDNDGKINFEEFRTMMRSGSSLQPQREL 480 >At4g04720.1 68417.m00693 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase(CDPK) [Carrot] SWISS-PROT:P28582 Length = 531 Score = 45.2 bits (102), Expect = 5e-06 Identities = 22/58 (37%), Positives = 33/58 (56%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+EE+I K F+ D D GTIT +EL T + LG +E E++ ++ D D Sbjct: 374 AESLSEEEIKGLKTMFANIDTDKSGTITYEELKTGLTRLGSRLSETEVKQLMEAADVD 431 Score = 40.7 bits (91), Expect = 1e-04 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +AF FDKD G IT EL + M+ G EA ++++I+EVD D Sbjct: 459 KAFQHFDKDNSGHITRDELESAMKEYGMG-DEASIKEVISEVDTD 502 Score = 27.5 bits (58), Expect = 1.1 Identities = 14/34 (41%), Positives = 16/34 (47%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP 48 A KE S D D DG I +E +MRS P Sbjct: 490 ASIKEVISEVDTDNDGRINFEEFCAMMRSGSTQP 523 >At3g50770.1 68416.m05560 calmodulin-related protein, putative similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum] Length = 205 Score = 45.2 bits (102), Expect = 5e-06 Identities = 22/49 (44%), Positives = 29/49 (59%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADA 64 E ++ FS FD DGDG I+ EL S+G+ + Q+ INEVD DA Sbjct: 64 ELRQVFSHFDSDGDGKISAFELRHYFGSVGEYISHEAAQEAINEVDTDA 112 Score = 34.3 bits (75), Expect = 0.010 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query: 16 EFKEAFSLFDKD-GDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E K AF +F+ + G G IT K L ++ LG++ T E + MI D D Sbjct: 141 ELKTAFEMFEVEKGSGCITPKGLQKMLVKLGESRTYGECEAMIKFYDID 189 >At1g61950.1 68414.m06988 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GI:3283996 from [Nicotiana tabacum]; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 551 Score = 44.8 bits (101), Expect = 7e-06 Identities = 23/66 (34%), Positives = 33/66 (50%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAY 65 A L EE++ K F+ D D GTIT EL + + LG TE E++ ++ + D D Sbjct: 394 AQNLKEEELKGLKTMFANMDTDKSGTITYDELKSGLEKLGSRLTETEVKQLLEDADVDGN 453 Query: 66 EKWRYI 71 YI Sbjct: 454 GTIDYI 459 Score = 36.7 bits (81), Expect = 0.002 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +AF FDKD G I+ +EL T M+ + ++++I+EVDAD Sbjct: 479 KAFQHFDKDNSGFISRQELETAMKEYNMG-DDIMIKEIISEVDAD 522 Score = 26.2 bits (55), Expect = 2.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQN 47 KE S D D DG+I +E +M+S Q+ Sbjct: 513 KEIISEVDADNDGSINYQEFCNMMKSCSQS 542 >At3g20410.1 68416.m02585 calmodulin-domain protein kinase isoform 9 (CPK9) identical to calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis thaliana] gi|1399265|gb|AAB03242 Length = 541 Score = 44.4 bits (100), Expect = 9e-06 Identities = 23/66 (34%), Positives = 34/66 (51%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAY 65 A+ + E+I K F+ D D GTIT +EL + LG TEAE++ +++ D D Sbjct: 386 AENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLAKLGSKLTEAEVKQLMDAADVDGN 445 Query: 66 EKWRYI 71 YI Sbjct: 446 GSIDYI 451 Score = 36.3 bits (80), Expect = 0.002 Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +AF FDKD G IT EL + ++ G +A +++++++VD+D Sbjct: 471 KAFQHFDKDSSGYITIDELESALKEYGMG-DDATIKEVLSDVDSD 514 Score = 26.2 bits (55), Expect = 2.7 Identities = 13/29 (44%), Positives = 15/29 (51%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRS 43 A KE S D D DG I +E +MRS Sbjct: 502 ATIKEVLSDVDSDNDGRINYEEFCAMMRS 530 >At3g10190.1 68416.m01220 calmodulin, putative similar to calmodulin NtCaM13 [Nicotiana tabacum] GI:14625425, calmodulin GB:AAA34015 [Glycine max]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 209 Score = 44.4 bits (100), Expect = 9e-06 Identities = 20/49 (40%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP-TEAELQDMINEVDAD 63 E +AF L D+D DG ++ +L +++ LG +P TE E+ M+ EVD D Sbjct: 70 EILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEEEINVMLKEVDCD 118 Score = 35.9 bits (79), Expect = 0.003 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDAD 63 E KE F FD D DG I+ EL V ++G + T + + MI +VD D Sbjct: 143 ELKETFEFFDADRDGLISADELLRVFSTIGDERCTLDDCKRMIADVDED 191 Score = 34.3 bits (75), Expect = 0.010 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 5/61 (8%) Query: 4 MAADQLTEEQI-AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 + D LTEE+I KE D DGDGTI +EL + + SL EL++ DA Sbjct: 98 LGPDPLTEEEINVMLKEV----DCDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDA 153 Query: 63 D 63 D Sbjct: 154 D 154 >At1g50700.1 68414.m05701 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 9 [Arabidopsis thaliana] gi|1399265|gb|AAB03242 Length = 521 Score = 44.4 bits (100), Expect = 9e-06 Identities = 23/66 (34%), Positives = 34/66 (51%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAY 65 A+ + E+I K F+ D D GTIT +EL + LG TEAE++ +++ D D Sbjct: 368 AENIDTEEIQGLKAMFANIDTDNSGTITYEELKEGLAKLGSRLTEAEVKQLMDAADVDGN 427 Query: 66 EKWRYI 71 YI Sbjct: 428 GSIDYI 433 Score = 41.9 bits (94), Expect = 5e-05 Identities = 19/45 (42%), Positives = 30/45 (66%), Gaps = 1/45 (2%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +AF FDKDG G ITT EL ++ G +A +++++++VDAD Sbjct: 453 KAFQHFDKDGSGYITTDELEAALKEYGMG-DDATIKEILSDVDAD 496 Score = 25.4 bits (53), Expect = 4.6 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAEL 53 A KE S D D DG I E +MRS NP + L Sbjct: 484 ATIKEILSDVDADNDGRINYDEFCAMMRS--GNPQQPRL 520 >At3g07490.1 68416.m00893 calcium-binding protein, putative similar to calcium-binding protein GI:6580549 from [Lotus japonicus] Length = 153 Score = 43.6 bits (98), Expect = 2e-05 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 2/50 (4%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLG--QNPTEAELQDMINEVDAD 63 + +EAF++FD++ DG IT +EL +V+ SLG Q T + + MI++VD D Sbjct: 78 DMREAFNVFDQNRDGFITVEELRSVLASLGLKQGRTLEDCKRMISKVDVD 127 Score = 40.3 bits (90), Expect = 2e-04 Identities = 18/47 (38%), Positives = 28/47 (59%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 AE F +FD++GDG IT +EL + +LG + +L MI ++D Sbjct: 4 AELARIFQMFDRNGDGKITKQELNDSLENLGIYIPDKDLVQMIEKID 50 >At2g17290.1 68415.m01997 calcium-dependent protein kinase isoform 6 (CPK6) identical to calmodulin-domain protein kinase CDPK isoform 6 [Arabidopsis thaliana] gi|1399275|gb|AAB03246; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 544 Score = 43.6 bits (98), Expect = 2e-05 Identities = 20/58 (34%), Positives = 30/58 (51%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+EE+IA + F D D G IT EL +R G + E++D++ D D Sbjct: 380 AESLSEEEIAGLRAMFEAMDTDNSGAITFDELKAGLRRYGSTLKDTEIRDLMEAADVD 437 Score = 36.3 bits (80), Expect = 0.002 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AF FDKDG G IT EL + T+ L+D+I EVD D Sbjct: 466 AFQYFDKDGSGYITIDEL--QQSCIEHGMTDVFLEDIIKEVDQD 507 >At5g19360.1 68418.m02307 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Marchantia polymorpha] gi|5162877|dbj|BAA81748 Length = 523 Score = 43.2 bits (97), Expect = 2e-05 Identities = 22/55 (40%), Positives = 30/55 (54%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 L+EE+I KE F D D GTIT +EL + G +E E+Q ++ DAD Sbjct: 366 LSEEEIMGLKEMFKGMDTDNSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADAD 420 Score = 41.9 bits (94), Expect = 5e-05 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AF FDKD G ITT+EL +R G N +++++I+EVD D Sbjct: 449 AFQHFDKDNSGYITTEELEQALREFGMNDGR-DIKEIISEVDGD 491 Score = 25.4 bits (53), Expect = 4.6 Identities = 12/41 (29%), Positives = 20/41 (48%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDM 56 + KE S D D DG I +E +MR +P + +++ Sbjct: 480 DIKEIISEVDGDNDGRINYEEFVAMMRKGNPDPNPKKRREL 520 >At5g12180.1 68418.m01429 calcium-dependent protein kinase, putative / CDPK, putative Length = 528 Score = 43.2 bits (97), Expect = 2e-05 Identities = 22/55 (40%), Positives = 30/55 (54%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 L+EE+I KE F D D GTIT +EL + G +E E+Q ++ DAD Sbjct: 371 LSEEEIMGLKEMFKGMDTDSSGTITLEELRQGLAKQGTRLSEYEVQQLMEAADAD 425 Score = 39.5 bits (88), Expect = 3e-04 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AF FDKD G IT +EL +R G N +++++I+EVD D Sbjct: 454 AFQHFDKDNSGYITMEELEQALREFGMNDGR-DIKEIISEVDGD 496 >At4g04700.1 68417.m00690 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423; contains protein kinase domain, Pfam:PF00069 Length = 485 Score = 42.7 bits (96), Expect = 3e-05 Identities = 21/58 (36%), Positives = 32/58 (55%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A L+EE+I K F+ D D G IT +EL T + LG N ++ E++ ++ D D Sbjct: 326 AANLSEEEIKGLKTLFTNIDTDKSGNITLEELKTGLTRLGSNLSKTEVEQLMEAADMD 383 Score = 35.1 bits (77), Expect = 0.006 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +AF FDKD DG IT +EL M+ G E ++ +I + D D Sbjct: 411 KAFQHFDKDNDGHITKEELEMAMKEDGAG-DEGSIKQIIADADTD 454 Score = 28.3 bits (60), Expect = 0.66 Identities = 15/41 (36%), Positives = 21/41 (51%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN 58 K+ + D D DG I +E T+MR+ E EL +IN Sbjct: 445 KQIIADADTDNDGKINFEEFRTMMRTESSLQPEGELLPIIN 485 >At2g38910.1 68415.m04783 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK) [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 583 Score = 42.7 bits (96), Expect = 3e-05 Identities = 20/62 (32%), Positives = 35/62 (56%) Query: 2 VVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 + + A+ L+EE+IA KE F + D D G IT +EL + +G + ++E+ ++ D Sbjct: 425 IKVIAESLSEEEIAGLKEMFKMIDTDNSGHITLEELKKGLDRVGADLKDSEILGLMQAAD 484 Query: 62 AD 63 D Sbjct: 485 ID 486 Score = 37.1 bits (82), Expect = 0.001 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AFS FD+DG G IT EL + G + L D++ EVD D Sbjct: 515 AFSYFDQDGSGYITRDELQQACKQFGL--ADVHLDDILREVDKD 556 >At4g04710.1 68417.m00692 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 575 Score = 42.3 bits (95), Expect = 4e-05 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E +AF FDKD G IT EL + M+ G EA ++++I+EVD D Sbjct: 507 EIDKAFQHFDKDNSGHITRDELESAMKEYGMG-DEASIKEVISEVDTD 553 Score = 38.3 bits (85), Expect = 6e-04 Identities = 20/58 (34%), Positives = 31/58 (53%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+EE+I K F D D G+IT +EL + G +E E++ ++ V AD Sbjct: 326 AEGLSEEEIKGLKTMFENMDMDKSGSITYEELKMGLNRHGSKLSETEVKQLMEAVSAD 383 Score = 38.3 bits (85), Expect = 6e-04 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 +AF FDKDG G IT +E+ M+ G EA +D+I+E D Sbjct: 413 KAFQYFDKDGSGHITKEEVEIAMKEHGMG-DEANAKDLISEFD 454 Score = 27.9 bits (59), Expect = 0.87 Identities = 13/29 (44%), Positives = 18/29 (62%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRS 43 A K+ S FDK+ DG I +E T+MR+ Sbjct: 444 ANAKDLISEFDKNNDGKIDYEEFCTMMRN 472 >At1g74740.1 68414.m08660 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604880|dbj|BAA04829; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 541 Score = 41.1 bits (92), Expect = 9e-05 Identities = 21/59 (35%), Positives = 30/59 (50%) Query: 12 EQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWRY 70 E F++AF FDKDG G I ++EL + P + + D++ EVD D K Y Sbjct: 432 ENDEHFRQAFMFFDKDGSGYIESEELREALTDELGEPDNSVIIDIMREVDTDKDGKINY 490 Score = 34.7 bits (76), Expect = 0.008 Identities = 16/58 (27%), Positives = 31/58 (53%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+ +++ + F+L D D DG I+ EL +R +G E E++ ++ D + Sbjct: 354 AEHLSIQEVEVIRNMFTLMDDDNDGKISYLELRAGLRKVGSQLGEPEIKLLMEVADVN 411 >At3g03430.1 68416.m00341 polcalcin, putative / calcium-binding pollen allergen, putative almost identical to polcalcin Bra r 2/Bra n 2 (calcium-binding pollen allergen Bra r 2/Bra n 2) SP:Q39406 from [Brassica napus] Length = 83 Score = 40.7 bits (91), Expect = 1e-04 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AE F FD +GDG I+ ELG +++LG + T +++ M+ E+D D Sbjct: 8 AEHDRIFKKFDANGDGKISAAELGDALKNLG-SVTHEDIKRMMAEIDTD 55 >At3g03400.1 68416.m00337 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 137 Score = 40.3 bits (90), Expect = 2e-04 Identities = 20/56 (35%), Positives = 29/56 (51%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWRYI 71 E K+AF L+D + DG I+ EL VM LG+ T M+ +D D R++ Sbjct: 80 ELKDAFKLYDINCDGKISANELHVVMTRLGEKCTVESCVGMVQAIDVDGDGYIRFV 135 >At4g20780.1 68417.m03017 calcium-binding protein, putative similar to SP|Q09011 Calcium-binding protein CAST {Solanum tuberosum}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 191 Score = 39.5 bits (88), Expect = 3e-04 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Query: 12 EQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG--QNPTEAELQDMINEVD 61 E ++ EAF +FD++GDG I+ +EL TV++ LG + ++ MI VD Sbjct: 116 ENESDLAEAFKVFDENGDGFISARELQTVLKKLGLPEGGEMERVEKMIVSVD 167 Score = 37.5 bits (83), Expect = 0.001 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Query: 21 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 F LFDK+GDG IT +EL + LG N A+L D+ + V++ Sbjct: 34 FDLFDKNGDGFITVEELSQALTRLGLN---ADLSDLKSTVES 72 >At5g44460.1 68418.m05448 calcium-binding protein, putative similar to SP|Q09011 Calcium-binding protein CAST {Solanum tuberosum}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 181 Score = 39.1 bits (87), Expect = 4e-04 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 4/52 (7%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQD---MINEVDAD 63 ++ +EAF++FD+DGDG I+ EL V++ LG P E++ MI VD++ Sbjct: 110 SDLEEAFNVFDEDGDGFISAVELQKVLKKLGL-PEAGEIEQVEKMIVSVDSN 160 Score = 33.9 bits (74), Expect = 0.013 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Query: 21 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 F LFDK+ DG IT +EL + LG +A+ D+ + VD+ Sbjct: 33 FDLFDKNNDGFITVEELSQALSRLG---LDADFSDLKSTVDS 71 >At4g04740.1 68417.m00695 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Lycopersicon esculentum] gi|19171502|emb|CAC87494 Length = 520 Score = 39.1 bits (87), Expect = 4e-04 Identities = 20/60 (33%), Positives = 33/60 (55%) Query: 4 MAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ++A L+EE+I K F+ D + GTIT ++L T + L +E E+Q ++ D D Sbjct: 361 VSAVSLSEEEIKGLKTLFANMDTNRSGTITYEQLQTGLSRLRSRLSETEVQQLVEASDVD 420 Score = 37.9 bits (84), Expect = 8e-04 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +AF DKD +G IT EL + M+ G EA ++++I+EVD D Sbjct: 448 KAFQHLDKDKNGHITRDELESAMKEYGMG-DEASIKEVISEVDTD 491 Score = 25.4 bits (53), Expect = 4.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMR 42 A KE S D D DG I +E +MR Sbjct: 479 ASIKEVISEVDTDNDGKINFEEFRAMMR 506 >At3g51850.1 68416.m05686 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 528 Score = 39.1 bits (87), Expect = 4e-04 Identities = 18/56 (32%), Positives = 31/56 (55%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 A+ L+ E++ + K F+ D D DG ++ +EL +R E+E+Q +I VD Sbjct: 349 AEFLSTEEVEDIKVMFNKMDTDNDGIVSIEELKAGLRDFSTQLAESEVQMLIEAVD 404 Score = 37.1 bits (82), Expect = 0.001 Identities = 18/46 (39%), Positives = 26/46 (56%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ++AFS FDKDG+G I +EL ++ G + D+ EVD D Sbjct: 433 RKAFSYFDKDGNGYILPQELCDALKEDGGDDCVDVANDIFQEVDTD 478 >At1g18890.1 68414.m02351 calcium-dependent protein kinase 1 (CDPK1) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604880|dbj|BAA04829; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 545 Score = 39.1 bits (87), Expect = 4e-04 Identities = 19/58 (32%), Positives = 31/58 (53%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+ +++ K FSL D D DG IT EL ++ +G E E++ ++ D D Sbjct: 358 AEHLSIQEVEVIKNMFSLMDDDKDGKITYPELKAGLQKVGSQLGEPEIKMLMEVADVD 415 Score = 35.5 bits (78), Expect = 0.004 Identities = 19/47 (40%), Positives = 23/47 (48%) Query: 17 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 FK AF FDKDG I EL + P + L D++ EVD D Sbjct: 441 FKLAFMFFDKDGSTYIELDELREALADELGEPDASVLSDIMREVDTD 487 >At5g12480.1 68418.m01466 calmodulin-domain protein kinase isoform 7 (CPK7) identical to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 535 Score = 38.3 bits (85), Expect = 6e-04 Identities = 19/58 (32%), Positives = 31/58 (53%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A+ L+ E+ A KEAF + D + G I +EL ++ GQ + +LQ ++ D D Sbjct: 354 AEHLSVEEAAGIKEAFEMMDVNKRGKINLEELKYGLQKAGQQIADTDLQILMEATDVD 411 >At2g15680.1 68415.m01795 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 187 Score = 38.3 bits (85), Expect = 6e-04 Identities = 18/54 (33%), Positives = 28/54 (51%) Query: 10 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ++ + E + FS FD D DG I+ E V+R+LGQ ++ + VD D Sbjct: 44 SQPSVNEMRRVFSRFDLDKDGKISQTEYKVVLRALGQERAIEDVPKIFKAVDLD 97 Score = 36.7 bits (81), Expect = 0.002 Identities = 16/49 (32%), Positives = 30/49 (61%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ++ + +F FD +GDG I+ +E+ +V+ LG+ + + M+ VDAD Sbjct: 120 SDIRNSFWTFDLNGDGKISAEEVMSVLWKLGERCSLEDCNRMVRAVDAD 168 >At5g19450.2 68418.m02318 calcium-dependent protein kinase 19 (CDPK19) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655 Length = 533 Score = 37.9 bits (84), Expect = 8e-04 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP-TEAELQDMINEVDAD 63 A+ L+ E++A KEAF + D G I +EL + LGQ + +LQ ++ D D Sbjct: 352 AEHLSVEEVAGIKEAFEMMDSKKTGKINLEELKFGLHKLGQQQIPDTDLQILMEAADVD 410 >At5g19450.1 68418.m02317 calcium-dependent protein kinase 19 (CDPK19) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655 Length = 533 Score = 37.9 bits (84), Expect = 8e-04 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP-TEAELQDMINEVDAD 63 A+ L+ E++A KEAF + D G I +EL + LGQ + +LQ ++ D D Sbjct: 352 AEHLSVEEVAGIKEAFEMMDSKKTGKINLEELKFGLHKLGQQQIPDTDLQILMEAADVD 410 >At2g31500.1 68415.m03848 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|836942|gb|AAA67655; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 582 Score = 37.9 bits (84), Expect = 8e-04 Identities = 17/60 (28%), Positives = 33/60 (55%) Query: 4 MAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + AD L E+IA + F D D +G +T +EL ++ +GQ + +++ +++ D D Sbjct: 359 IVADNLPNEEIAAIVQMFQTMDTDKNGHLTFEELRDGLKKIGQVVPDGDVKMLMDAADTD 418 Score = 27.9 bits (59), Expect = 0.87 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Query: 18 KEAFSLFDKDGDGTITTKELGTVM--RSLGQ-NPTEAELQDMINEVD 61 +EAF FDK+G+G I EL + LG N + ++D+ +VD Sbjct: 445 QEAFKYFDKNGNGFIELDELKVALCDDKLGHANGNDQWIKDIFFDVD 491 >At3g03410.1 68416.m00339 calmodulin-related protein, putative similar to calmodulin-related protein 2, touch-induced SP:P25070 from [Arabidopsis thaliana] Length = 131 Score = 37.1 bits (82), Expect = 0.001 Identities = 23/62 (37%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN--EVDAD 63 AD+ T KE F D DGDG I E M SLG+ TE + + +VD D Sbjct: 56 ADEFTSCIEKMLKEVFVFCDVDGDGKIPASESYVTMTSLGKKFTEETSAEKVRAADVDGD 115 Query: 64 AY 65 Y Sbjct: 116 GY 117 Score = 28.7 bits (61), Expect = 0.50 Identities = 13/46 (28%), Positives = 21/46 (45%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 K F FDK+ DG ++ E V + T+ ++ E+D D Sbjct: 4 KRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVD 49 >At5g49480.1 68418.m06123 sodium-inducible calcium-binding protein (ACP1) / sodium-responsive calcium-binding protein (ACP1) identical to NaCl-inducible Ca2+-binding protein GI:2352828 from [Arabidopsis thaliana] Length = 160 Score = 36.7 bits (81), Expect = 0.002 Identities = 17/46 (36%), Positives = 26/46 (56%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 K+ F + DKDGDG ++ +L + M S G T+ E++ MI D Sbjct: 99 KDVFKVMDKDGDGRLSYGDLKSYMDSAGLAVTDDEIKSMIRLAGGD 144 Score = 30.7 bits (66), Expect = 0.12 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Query: 17 FKEAFSLFDKDGDGTITTKELGTVMRSL--GQNPTEAELQDMINEVDAD 63 F+ AF + D D DG I++ +L + G+N E + MI+ DA+ Sbjct: 19 FRPAFEIIDTDHDGKISSDDLRAFYAGIPSGENNDETMIGTMISVADAN 67 >At1g76650.1 68414.m08919 calcium-binding EF hand family protein similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 177 Score = 36.7 bits (81), Expect = 0.002 Identities = 18/54 (33%), Positives = 32/54 (59%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADA 64 EE+ E K AF L+ +G+ IT + L +++ LG++ T + + MI+ D +A Sbjct: 110 EEKKMELKGAFRLYIAEGEDCITPRSLKMMLKKLGESRTTDDCRVMISAFDLNA 163 Score = 29.1 bits (62), Expect = 0.38 Identities = 15/53 (28%), Positives = 26/53 (49%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E++ E + FS D + DG I+ +EL +LG+ ++ E + D D Sbjct: 38 EDKNRELEAVFSYMDANRDGRISPEELQKSFMTLGEQLSDEEAVAAVRLSDTD 90 >At5g17480.1 68418.m02051 polcalcin, putative / calcium-binding pollen allergen, putative similar to polcalcin Bra r 2/Bra n 2 (Calcium-binding pollen allergen Bra r 2/Bra n 2) SP:Q39406 from [Brassica napus] Length = 83 Score = 36.3 bits (80), Expect = 0.002 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AE F FD +GDG I+ EL +++LG + T +++ M+ E+D D Sbjct: 8 AEHDRIFKKFDANGDGKISAAELEEALKTLG-SVTADDVKRMMAEIDTD 55 >At2g45670.1 68415.m05678 calcineurin B subunit-related contains Pfam PF00036: EF hand domain and Prosite PS00018: EF-hand calcium-binding domain; contains Pfam profile PF01553: Acyltransferase; weak similarity to Calcineurin B subunit isoform 2 (Protein phosphatase 2B regulatory subunit 2) (Protein phosphatase 3 regulatory subunit B alpha isoform 2) (Swiss-Prot:Q63811) [Mus musculus] Length = 539 Score = 36.3 bits (80), Expect = 0.002 Identities = 18/44 (40%), Positives = 27/44 (61%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AFS D DGDG IT +ELG +++ N + E++ M + +D D Sbjct: 465 AFSHCDADGDGYITIQELGEALKNTIPNLNKDEIRGMYHLLDDD 508 >At2g41860.2 68415.m05174 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 530 Score = 35.9 bits (79), Expect = 0.003 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN--EVDAD 63 A+ L+ E+ + KE F + D G IT ELG ++ LG + ++Q +++ +VD D Sbjct: 349 AEHLSVEETSCIKERFQVMDTSNRGKITITELGIGLQKLGIVVPQDDIQILMDAGDVDKD 408 Query: 64 AY 65 Y Sbjct: 409 GY 410 Score = 28.3 bits (60), Expect = 0.66 Identities = 16/53 (30%), Positives = 27/53 (50%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWRY 70 K+AF+ FDK+ G I +EL + +E ++ +I +VD + K Y Sbjct: 433 KKAFTFFDKNKSGYIEIEELRDALADDVDTTSEEVVEAIILDVDTNKDGKISY 485 >At2g41860.1 68415.m05173 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 425 Score = 35.9 bits (79), Expect = 0.003 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN--EVDAD 63 A+ L+ E+ + KE F + D G IT ELG ++ LG + ++Q +++ +VD D Sbjct: 244 AEHLSVEETSCIKERFQVMDTSNRGKITITELGIGLQKLGIVVPQDDIQILMDAGDVDKD 303 Query: 64 AY 65 Y Sbjct: 304 GY 305 Score = 28.3 bits (60), Expect = 0.66 Identities = 16/53 (30%), Positives = 27/53 (50%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWRY 70 K+AF+ FDK+ G I +EL + +E ++ +I +VD + K Y Sbjct: 328 KKAFTFFDKNKSGYIEIEELRDALADDVDTTSEEVVEAIILDVDTNKDGKISY 380 >At1g76640.1 68414.m08918 calmodulin-related protein, putative similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum] Length = 159 Score = 35.5 bits (78), Expect = 0.004 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Query: 1 MVVMAADQLTEEQIA-EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE 59 +++ D+ TEE+ + EAF ++ DG+ IT L ++ LG++ T + + MI Sbjct: 81 LLIKGNDEFTEEEKKRKIMEAFRMYIADGEDCITPGSLKMMLMKLGESRTTDDCKVMIQA 140 Query: 60 VDADA 64 D +A Sbjct: 141 FDLNA 145 Score = 31.9 bits (69), Expect = 0.053 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQ--NPTEAELQDMINEVDAD 63 EE+ + + F+ D + DG I+ +EL ++LG+ + EAE ++++D D Sbjct: 17 EEKNRDLEAVFAYMDANRDGRISAEELKKSFKTLGEQMSDEEAEAAVKLSDIDGD 71 >At2g41410.1 68415.m05110 calmodulin, putative identical to SP|P30188 Calmodulin-like protein {Arabidopsis thaliana} Length = 216 Score = 35.1 bits (77), Expect = 0.006 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVD 61 E +AF L D+D DG ++ +L ++ L + P++ E+ M+ EVD Sbjct: 70 ELVQAFKLIDRDDDGVVSRGDLAALISRLSHEPPSQEEVSLMLREVD 116 Score = 31.5 bits (68), Expect = 0.071 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLG-QNPTEAELQDMINEVDAD 63 E +E F +FD D +G I+ +EL V +G + T E MI VD + Sbjct: 145 ELREVFEIFDVDRNGKISAEELHRVFGVIGDERCTLEECMRMIATVDGN 193 >At2g35890.1 68415.m04406 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK). [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 520 Score = 35.1 bits (77), Expect = 0.006 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAY 65 A++L+EE+I E +E F D G +T KEL + N +++ ++ ++ D + Sbjct: 427 AERLSEEEIHELRETFKTIDSGKSGRVTYKELKNGLERFNTNLDNSDINSLM-QIPTDVH 485 >At1g73440.1 68414.m08501 calmodulin-related low similarity to calmodulin 8 [Arabidopsis thaliana] GI:5825600; contains Pfam profiles PF02809: Ubiquitin interaction motif, PF00036: EF hand Length = 254 Score = 35.1 bits (77), Expect = 0.006 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +M+ Q+T++++ + F FD+ G G IT +++ + TE ELQDMI D Sbjct: 174 LMSKTQMTQDELVMY---FCQFDEGGKGFITLRDVAKMATVHDFTWTEEELQDMIRCFDM 230 Query: 63 D 63 D Sbjct: 231 D 231 >At3g17470.1 68416.m02232 RelA/SpoT domain-containing protein / calcium-binding EF-hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain, Pfam profile PF04607: Region found in RelA / SpoT proteins Length = 583 Score = 33.9 bits (74), Expect = 0.013 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Query: 21 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADA 64 F L DK+GDG I+ +EL VM LG +AE +M+ +D+++ Sbjct: 479 FCLLDKNGDGMISIEELMEVMEELGAPGEDAE--EMMQLLDSNS 520 >At3g57530.1 68416.m06406 calcium-dependent protein kinase, putative / CDPK, putative similar to calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|1399277|gb|AAB03247 Length = 538 Score = 33.5 bits (73), Expect = 0.018 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN--EVDAD 63 A+ L++E+ + +E F + D G I EL ++ LG + +LQ +++ ++D D Sbjct: 358 AEHLSDEEASGIREGFQIMDTSQRGKINIDELKIGLQKLGHAIPQDDLQILMDAGDIDRD 417 Query: 64 AY 65 Y Sbjct: 418 GY 419 Score = 26.6 bits (56), Expect = 2.0 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 K+AF+ FD++ +G I +EL + S +E + +I +VD D Sbjct: 442 KKAFAFFDQNNNGYIEIEELREAL-SDELGTSEEVVDAIIRDVDTD 486 >At3g47480.1 68416.m05163 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 183 Score = 33.5 bits (73), Expect = 0.018 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNP-TEAELQDMINEVD 61 KEAF LFD++ DG I EL V+ LG + T+ E + M+ D Sbjct: 118 KEAFRLFDENQDGFIDENELKHVLSLLGYDECTKMECRKMVKVYD 162 >At5g42380.1 68418.m05160 calmodulin-related protein, putative similar to regulator of gene silencing calmodulin-related protein GI:12963415 from [Nicotiana tabacum] Length = 185 Score = 31.5 bits (68), Expect = 0.071 Identities = 18/55 (32%), Positives = 27/55 (49%) Query: 7 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 D EE+ E KEAF ++ +G+ IT L + LG++ T + MI D Sbjct: 114 DGSDEERRKELKEAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKVMIRGFD 168 Score = 29.9 bits (64), Expect = 0.22 Identities = 13/50 (26%), Positives = 26/50 (52%) Query: 14 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + E + F D + DG I+ +EL + + LG + E+++++ D D Sbjct: 47 VNELRTVFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVKTSDVD 96 >At3g29000.1 68416.m03624 calcium-binding EF hand family protein similar to calmodulin-like MSS3 GI:9965747 from [Arabidopsis thaliana]; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 194 Score = 31.5 bits (68), Expect = 0.071 Identities = 15/35 (42%), Positives = 21/35 (60%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG 45 E + E K+AF +FD++ DG I EL V+ LG Sbjct: 121 EASLEEVKQAFDVFDENKDGFIDAIELQRVLTILG 155 >At3g05310.1 68416.m00579 GTP-binding protein-related low similarity to rac 1 protein [Physcomitrella patens] GI:7243743; contains Pfam profile PF00036: EF hand (domain) Length = 648 Score = 31.5 bits (68), Expect = 0.071 Identities = 14/56 (25%), Positives = 26/56 (46%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +LT I +E + FD +GD + E+G + + ++P L + E + D Sbjct: 312 ELTNVAIEFLREVYEFFDSNGDNNLEPHEMGYLFETAPESPWTKPLYKDVTEENMD 367 >At3g10300.3 68416.m01236 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 335 Score = 31.1 bits (67), Expect = 0.093 Identities = 15/48 (31%), Positives = 25/48 (52%) Query: 14 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 + ++ F FDKD G I T EL + SLG + + L ++++ D Sbjct: 232 LQNWRSIFERFDKDRSGRIDTNELRDALMSLGFSVSPVILDLLVSKFD 279 >At3g10300.2 68416.m01235 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 324 Score = 31.1 bits (67), Expect = 0.093 Identities = 15/48 (31%), Positives = 25/48 (52%) Query: 14 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 + ++ F FDKD G I T EL + SLG + + L ++++ D Sbjct: 232 LQNWRSIFERFDKDRSGRIDTNELRDALMSLGFSVSPVILDLLVSKFD 279 >At3g56760.1 68416.m06313 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana tabacum] gi|16904226|gb|AAL30820 Length = 577 Score = 30.7 bits (66), Expect = 0.12 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQN-PTEAELQDMINEVD 61 + A+ L++KDG+ I +EL T + LG + P LQD I D Sbjct: 511 RRAYELYEKDGNRVIMIEELATEL-GLGPSVPVHVVLQDWIRHSD 554 >At1g21550.1 68414.m02695 calcium-binding protein, putative contains similarity to calcium-binding protein GB:CAB63264 GI:6580549 from [Lotus japonicus] Length = 155 Score = 30.7 bits (66), Expect = 0.12 Identities = 13/26 (50%), Positives = 19/26 (73%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLG 45 AF++FD +GDG I+ +EL V+ LG Sbjct: 93 AFNVFDVNGDGYISAEELRDVLERLG 118 Score = 29.1 bits (62), Expect = 0.38 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLG---QNPTEAELQDMINEVDADAYEKWRY 70 + + F DK+ DG +T EL ++ LG P E EL +D D + ++ Y Sbjct: 10 DLRRMFKTLDKNQDGLVTLDELLWILDKLGWAEHTPDELELIVGKQSLDLDEFLRFYY 67 >At5g39670.1 68418.m04804 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 204 Score = 29.9 bits (64), Expect = 0.22 Identities = 14/35 (40%), Positives = 21/35 (60%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG 45 E + E K+AF +FD++ DG I +L V+ LG Sbjct: 131 EPSLEEVKQAFDVFDENRDGFIDPIDLQRVLTILG 165 >At4g26470.1 68417.m03808 calcium-binding EF hand family protein low similarity to SP|P06787 Calmodulin {Saccharomyces cerevisiae}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 248 Score = 29.9 bits (64), Expect = 0.22 Identities = 15/51 (29%), Positives = 25/51 (49%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 ++ + K F FD+D +G+I EL +R L + E E+ D+ D Sbjct: 53 DDGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFDEEEINDLFKACD 103 >At2g41140.1 68415.m05081 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana tabacum] gi|16904226|gb|AAL30820 Length = 576 Score = 29.9 bits (64), Expect = 0.22 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQN-PTEAELQDMINEVD 61 + A+ LF+KDG+ I +EL + + LG + P LQD I D Sbjct: 510 RRAYELFEKDGNRPIMIEELASEL-GLGPSVPVHVVLQDWIRHSD 553 Score = 25.4 bits (53), Expect = 4.6 Identities = 15/63 (23%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGT-VMRSLGQNPTEAELQDMINEVDADA 64 A LT Q+A +E F+L +G I+ + T +++S ++ + D ++ + Sbjct: 421 AKTLTVPQLAYLREQFTLLGPSKNGYISMQNYKTAILKSSTDAMKDSRVFDFVHMISCLQ 480 Query: 65 YEK 67 Y+K Sbjct: 481 YKK 483 >At3g24110.1 68416.m03027 calcium-binding EF hand family protein contains Pfam profile: PF00036 EF hand, similar to calcium-modulated proteins Length = 229 Score = 29.1 bits (62), Expect = 0.38 Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Query: 2 VVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 ++M +L E + + F +D D +GTI +EL + L + ++ E++ + + D Sbjct: 44 IIMKFPKL-REGLRNIRSVFESYDNDTNGTIDIEELKKCLEELKLSLSDEEVKGLYSWCD 102 Query: 62 AD 63 D Sbjct: 103 VD 104 >At1g49580.1 68414.m05559 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana tabacum] gi|16904226|gb|AAL30820; contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 606 Score = 29.1 bits (62), Expect = 0.38 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE 59 L +++I K FSL + DG IT + T+ +L N TEA + I E Sbjct: 452 LIKDEILYLKTQFSLLAPNKDGLIT---MDTIRMALASNATEAMKESRIPE 499 Score = 29.1 bits (62), Expect = 0.38 Identities = 14/44 (31%), Positives = 22/44 (50%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 + A+ LFDK+G+ I +EL + + P + L D I D Sbjct: 538 RHAYELFDKNGNRAIVIEELASELGVGPSIPVHSVLHDWIRHTD 581 >At2g46700.1 68415.m05827 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase homolog MCK1 [Zea mays] gi|1839597|gb|AAB47181 Length = 595 Score = 28.3 bits (60), Expect = 0.66 Identities = 14/63 (22%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGT-VMRSLGQNPTEAELQDMINEVDADA 64 A LTE ++ + F L + DG+++ + T +M++ E+ + ++++ +++ A Sbjct: 440 AKALTENELVYLRAQFMLLGPNKDGSVSLENFKTALMQNATDAMRESRVPEILHTMESLA 499 Query: 65 YEK 67 Y K Sbjct: 500 YRK 502 >At1g23240.2 68414.m02908 caleosin-related family protein similar to caleosin GB:AAF13743 GI:6478218 from [Sesamum indicum]; similar to Ca+2-binding EF hand protein GB:AAB71227 [Glycine max]; contains Pfam profilePF05042: Caleosin related protein Length = 174 Score = 28.3 bits (60), Expect = 0.66 Identities = 14/44 (31%), Positives = 24/44 (54%) Query: 2 VVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLG 45 VV +L +E++ ++ S FD++ DGT+ E R+LG Sbjct: 24 VVYVGGKLDKEKMTALEKHVSFFDRNKDGTVYPWETYQGFRALG 67 >At4g32060.1 68417.m04563 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 498 Score = 27.9 bits (59), Expect = 0.87 Identities = 12/27 (44%), Positives = 16/27 (59%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVM 41 + F AF +FD D +G I +E TVM Sbjct: 246 SSFAVAFKMFDTDNNGEIDKEEFKTVM 272 Score = 25.0 bits (52), Expect = 6.1 Identities = 11/18 (61%), Positives = 12/18 (66%) Query: 19 EAFSLFDKDGDGTITTKE 36 E F LFD D DG I+ KE Sbjct: 216 EFFMLFDVDNDGLISFKE 233 >At3g20290.1 68416.m02571 calcium-binding EF hand family protein similar to EH-domain containing protein 1 from {Mus musculus} SP|Q9WVK4 and {Homo sapiens} SP|Q9H4M9, receptor-mediated endocytosis 1 from [Caenorhabditis elegans] GI:13487775, GI:13487777, GI:13487779; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 545 Score = 27.9 bits (59), Expect = 0.87 Identities = 13/30 (43%), Positives = 17/30 (56%) Query: 4 MAADQLTEEQIAEFKEAFSLFDKDGDGTIT 33 +AA ++E +KE F D DGDG IT Sbjct: 6 VAAGSCSKENQMIYKEWFEFSDSDGDGRIT 35 >At5g47910.1 68418.m05918 respiratory burst oxidase protein D (RbohD) / NADPH oxidase identical to respiratory burst oxidase protein D from Arabidopsis thaliana [gi:3242789] Length = 921 Score = 27.5 bits (58), Expect = 1.1 Identities = 11/36 (30%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query: 7 DQLTEEQI-AEFKEAFSLFDKDGDGTITTKELGTVM 41 +Q+++E A+ + F + DKD DG +T +E+ ++ Sbjct: 247 EQISDESFDAKLQVFFDMVDKDEDGRVTEEEVAEII 282 >At2g35800.1 68415.m04396 mitochondrial substrate carrier family protein contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 823 Score = 27.5 bits (58), Expect = 1.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMR 42 +E + F D+DGDG +T ++L MR Sbjct: 377 SEGRRFFEELDRDGDGKVTLEDLEIAMR 404 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 27.5 bits (58), Expect = 1.1 Identities = 10/42 (23%), Positives = 25/42 (59%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI 57 E +AF FD++ G + +++ + SLG+ + E+++++ Sbjct: 1274 ELLQAFRFFDRNQAGYVRVEDMRVTIHSLGKFLSHREVKELV 1315 >At1g06570.1 68414.m00696 4-hydroxyphenylpyruvate dioxygenase (HPD) identical to 4-hydroxyphenylpyruvate dioxygenase (HPD) SP:P93836 [Arabidopsis thaliana (Mouse-ear cress)] Length = 473 Score = 27.5 bits (58), Expect = 1.1 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Query: 7 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPT 49 D L+++QI E +E L D+D GT+ L + LG PT Sbjct: 380 DVLSDDQIKECEELGILVDRDDQGTL----LQIFTKPLGDRPT 418 >At3g63150.1 68416.m07092 GTP-binding protein-related low similarity to SP|Q38912 RAC-like GTP binding protein ARAC3 (GTP-binding protein ROP6) {Arabidopsis thaliana}; contains Pfam profile PF00036: EF hand (domain) Length = 643 Score = 27.1 bits (57), Expect = 1.5 Identities = 12/41 (29%), Positives = 20/41 (48%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP 48 +LT E + F L+D D DG + EL + ++ +P Sbjct: 311 ELTNEAMDFLSGIFQLYDLDNDGALQPAELDDLFQTAPDSP 351 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 26.6 bits (56), Expect = 2.0 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Query: 2 VVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKE 36 +V A ++ +E++A F E DKD +GTIT +E Sbjct: 129 LVKAGIEIDDEELARFVEHV---DKDNNGTITFEE 160 >At3g45810.1 68416.m04958 ferric reductase-like transmembrane component family protein similar to respiratory burst oxidase protein D RbohD from Arabidopsis thaliana, EMBL:AF055357 [gi:3242789], similar to respiratory burst oxidase protein D RbohD from Arabidopsis thaliana, EMBL:AF055357 [gi:3242789], respiratory burst oxidase homolog from Solanum tuberosum [GI:16549089]; contains Pfam profile PF01794 Ferric reductase like transmembrane component Length = 912 Score = 26.6 bits (56), Expect = 2.0 Identities = 11/35 (31%), Positives = 20/35 (57%) Query: 7 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVM 41 D + ++ + F + DKDGDG +T +E+ V+ Sbjct: 200 DMIKKDLDCRLQIFFDMCDKDGDGKLTEEEVKEVI 234 >At5g29560.1 68418.m03629 Ca+2-binding EF hand family protein contains similarity to Ca+2-binding EF hand protein GI:2270994 from [Glycine max] Length = 220 Score = 26.2 bits (55), Expect = 2.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQN 47 ++ + FD+DGDG I E R+LG N Sbjct: 66 QQHIAFFDQDGDGIIYPSETFRGFRALGFN 95 >At4g21490.1 68417.m03107 pyridine nucleotide-disulphide oxidoreductase family protein similar to GI:3718005 alternative NADH-dehydrogenase {Yarrowia lipolytica}; contains Pfam profile PF00070: Pyridine nucleotide-disulphide oxidoreductase Length = 568 Score = 26.2 bits (55), Expect = 2.7 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAEL 53 ++ E+ A FK+A DK+ GT+T KE VM + + EL Sbjct: 365 KVMEDIAAIFKKA----DKENSGTLTMKEFHEVMSDICDRYPQVEL 406 >At4g00140.1 68417.m00014 expressed protein Length = 257 Score = 26.2 bits (55), Expect = 2.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Query: 28 GDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 G G IT +++ + TE ELQDMI D D Sbjct: 93 GKGFITRRDVAKMATVHDFTWTEEELQDMIRSFDMD 128 >At3g57140.2 68416.m06362 patatin-related contains Patatin domain PF01734 Length = 801 Score = 26.2 bits (55), Expect = 2.7 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLG--QNPTEAELQDMINEVDADAYEK 67 +E SLF ++ +G +T T + L QNP+ E+Q N+ +EK Sbjct: 497 REVASLFAQEWEGDVTIVMPATFSQYLKIIQNPSNVEIQKAANQGRRCTWEK 548 >At3g57140.1 68416.m06361 patatin-related contains Patatin domain PF01734 Length = 801 Score = 26.2 bits (55), Expect = 2.7 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLG--QNPTEAELQDMINEVDADAYEK 67 +E SLF ++ +G +T T + L QNP+ E+Q N+ +EK Sbjct: 497 REVASLFAQEWEGDVTIVMPATFSQYLKIIQNPSNVEIQKAANQGRRCTWEK 548 >At3g50530.1 68416.m05526 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana tabacum] gi|16904226|gb|AAL30820 Length = 601 Score = 26.2 bits (55), Expect = 2.7 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQN-PTEAELQDMINEVD 61 A+ LF+K+G+ I EL + + LG + P A L D + D Sbjct: 537 AYELFEKEGNRPIMIDELASEL-GLGPSVPVHAVLHDWLRHTD 578 Score = 25.0 bits (52), Expect = 6.1 Identities = 10/60 (16%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP-TEAELQDMINEVDADAYEK 67 LT +++ +E F+L + +GTI+ + + + + + + ++ + + + ++ A Y + Sbjct: 449 LTVDELFYLREQFALLEPSKNGTISLENIKSALMKMATDAMKDSRIPEFLGQLSALQYRR 508 >At5g04170.1 68418.m00405 calcium-binding EF hand family protein low similarity to peflin [Homo sapiens] GI:6015440; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 354 Score = 25.8 bits (54), Expect = 3.5 Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 14 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 + ++ F DKD G I EL + SLG + + L ++++ D Sbjct: 251 LQNWRSIFERSDKDRSGRIDVNELRDALLSLGFSVSPVVLDLLVSKFD 298 >At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-related contains weak similarity to Calcium-binding mitochondrial protein Anon-60Da (Swiss-Prot:P91927) [Drosophila melanogaster] Length = 755 Score = 25.8 bits (54), Expect = 3.5 Identities = 12/45 (26%), Positives = 20/45 (44%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + + L D+D DG +T E+ L LQ +I+ + D Sbjct: 681 KGWQLLDRDRDGKVTPDEVAAAAMYLKDTLANDGLQQLISSLSKD 725 >At5g27540.1 68418.m03297 GTP-binding protein-related low similarity to Mig-2-like GTPase Mtl [Drosophila melanogaster] GI:7271872; contains Pfam profile PF00036: EF hand Length = 648 Score = 25.4 bits (53), Expect = 4.6 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP-TEAELQD 55 +LT I K + LFD D D + +E+ + + ++P EA +D Sbjct: 315 ELTNAAIDFLKGMYMLFDDDQDNNLRPQEIEDLFSTAPESPWKEAPYED 363 >At5g04040.1 68418.m00384 patatin-related contains Patatin domain PF01734 Length = 825 Score = 25.4 bits (53), Expect = 4.6 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Query: 23 LFDKDGDGTITTKELGTVMR--SLGQNPTEAELQDMINEVDADAYEK 67 LF ++ +G +T T+ + + QNPT ELQ N+ +EK Sbjct: 503 LFAQEWEGDVTVVMPATLAQYSKIIQNPTHVELQKAANQGRRCTWEK 549 >At3g03240.1 68416.m00320 esterase/lipase/thioesterase family protein contains Interpro entry IPR000379 Length = 333 Score = 25.4 bits (53), Expect = 4.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDG 30 ++T+E I EF+ F LFD+ G G Sbjct: 77 KITQEMIDEFEIYFLLFDRAGYG 99 >At1g73390.3 68414.m08497 expressed protein Length = 419 Score = 25.4 bits (53), Expect = 4.6 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Query: 2 VVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 + +AA Q +E + E K+A F+ + T GT+ + P E + IN D Sbjct: 312 MAVAALQAADECLKESKKASEAFNTSSPTSRTPSLFGTMKYLSEKIPKETSSKVRINR-D 370 Query: 62 ADAYEK 67 +YEK Sbjct: 371 LYSYEK 376 >At1g73390.2 68414.m08496 expressed protein Length = 419 Score = 25.4 bits (53), Expect = 4.6 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Query: 2 VVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 + +AA Q +E + E K+A F+ + T GT+ + P E + IN D Sbjct: 312 MAVAALQAADECLKESKKASEAFNTSSPTSRTPSLFGTMKYLSEKIPKETSSKVRINR-D 370 Query: 62 ADAYEK 67 +YEK Sbjct: 371 LYSYEK 376 >At1g73390.1 68414.m08495 expressed protein Length = 419 Score = 25.4 bits (53), Expect = 4.6 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Query: 2 VVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 + +AA Q +E + E K+A F+ + T GT+ + P E + IN D Sbjct: 312 MAVAALQAADECLKESKKASEAFNTSSPTSRTPSLFGTMKYLSEKIPKETSSKVRINR-D 370 Query: 62 ADAYEK 67 +YEK Sbjct: 371 LYSYEK 376 >At5g51060.1 68418.m06329 respiratory burst oxidase protein C (RbohC) / NADPH oxidase nearly identical to respiratory burst oxidase protein C from Arabidopsis thaliana [gi:3242785] Length = 905 Score = 25.0 bits (52), Expect = 6.1 Identities = 10/36 (27%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 7 DQLTEEQI-AEFKEAFSLFDKDGDGTITTKELGTVM 41 +Q+ ++ + K F + DKD DG +T E+ ++ Sbjct: 220 EQINDQSFDSRLKTFFDMVDKDADGRLTEDEVREII 255 >At5g17180.1 68418.m02013 hypothetical protein Length = 123 Score = 25.0 bits (52), Expect = 6.1 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 12 EQIAEFKEAFSLFDKDGDGTITTKELG-TVMRSLGQNPTEAELQDMINEV 60 + + +FKE F FD+ +G I +E T +R T++E+ + E+ Sbjct: 5 KDVKDFKETFQRFDQYVNGEIPWREFDMTGVRKRSTPMTKSEIDTIFVEL 54 >At4g25090.1 68417.m03604 respiratory burst oxidase, putative / NADPH oxidase, putative similar to respiratory burst oxidase protein A from Arabidopsis thaliana, gb:AF055353 [gi:3242781], protein D [gi:3242789]; contains Pfam profile PF01794 Ferric reductase like transmembrane component Length = 849 Score = 25.0 bits (52), Expect = 6.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 21 FSLFDKDGDGTITTKELGTVMR 42 F L DKD DG +T E+ +++ Sbjct: 185 FDLMDKDSDGRLTEDEVREIIK 206 >At4g05020.1 68417.m00736 NADH dehydrogenase-related similar to alternative NADH-dehydrogenase [Yarrowia lipolytica] GI:3718005, 64 kDa mitochondrial NADH dehydrogenase [Neurospora crassa] GI:4753821; contains Pfam profile PF00070: Pyridine nucleotide-disulphide oxidoreductase Length = 582 Score = 25.0 bits (52), Expect = 6.1 Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 21 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAEL 53 FS DKD GT+T KE M + + EL Sbjct: 388 FSKADKDKSGTLTLKEFQEAMDDICVRYPQVEL 420 >At3g09600.1 68416.m01140 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 298 Score = 25.0 bits (52), Expect = 6.1 Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 2 VVMAADQLTEEQIAEFKEAFSLFDKD 27 + + + TEE+ +F EA LFD+D Sbjct: 39 ITKSRESWTEEEHDKFLEALQLFDRD 64 >At3g03230.1 68416.m00319 esterase/lipase/thioesterase family protein contains Interpro entry IPR000379 Length = 333 Score = 25.0 bits (52), Expect = 6.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 9 LTEEQIAEFKEAFSLFDKDGDG 30 +T+E I EFK F FD+ G G Sbjct: 78 ITQEMIDEFKIYFLFFDRAGYG 99 >At5g60010.1 68418.m07525 ferric reductase-like transmembrane component family protein similar to respiratory burst oxidase protein D RbohD from Arabidopsis thaliana, EMBL:AF055357 [gi:3242789], respiratory burst oxidase homolog from Solanum tuberosum [GI:16549089]; contains Pfam profile PF01794 Ferric reductase like transmembrane component Length = 839 Score = 24.6 bits (51), Expect = 8.1 Identities = 10/35 (28%), Positives = 20/35 (57%) Query: 7 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVM 41 D + ++ + F + DK+GDG +T +E+ V+ Sbjct: 190 DMIKKDLDCRLQIFFDMCDKNGDGKLTEEEVKEVI 224 >At4g28510.1 68417.m04078 prohibitin, putative similar to SP|P24142 Prohibitin (B-cell receptor associated protein 32) (BAP 32) {Rattus norvegicus}; contains Pfam profile PF01145: SPFH domain / Band 7 family Length = 288 Score = 24.6 bits (51), Expect = 8.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 36 ELGTVMRSLGQNPTEAELQDMINE 59 +L + RSLG+N +E L +INE Sbjct: 111 QLPEIYRSLGENYSERVLPSIINE 134 >At3g18430.1 68416.m02343 calcium-binding EF hand family protein similar to Calcineurin B subunit (Protein phosphatase 2B regulatory subunit) (Calcineurin regulatory subunit) SP:P42322 from [Naegleria gruberi]; contains Pfam profile PF00036: EF hand Length = 175 Score = 24.6 bits (51), Expect = 8.1 Identities = 10/41 (24%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query: 21 FSLFDKDGDGTITTKELGTVMRSL-GQNPTEAELQDMINEV 60 F ++D D +G ++ K++ V+R L G ++ + + ++++V Sbjct: 100 FKVYDSDCNGKVSFKDIMEVLRDLSGSFMSDEQREQVLSQV 140 >At3g12210.2 68416.m01524 expressed protein Length = 209 Score = 24.6 bits (51), Expect = 8.1 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Query: 12 EQIAEFKEAFSLFDKDGDGTITTKELGTVMR-SLGQNPTEAELQDMINEVD 61 +Q K L D+D + +TT EL +M+ L + L D ++ +D Sbjct: 36 DQFYRIKLPCLLHDRDPNPYLTTSELSQLMKWKLSRGKWRPRLLDFVSSLD 86 >At3g12210.1 68416.m01523 expressed protein Length = 155 Score = 24.6 bits (51), Expect = 8.1 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Query: 12 EQIAEFKEAFSLFDKDGDGTITTKELGTVMR-SLGQNPTEAELQDMINEVD 61 +Q K L D+D + +TT EL +M+ L + L D ++ +D Sbjct: 36 DQFYRIKLPCLLHDRDPNPYLTTSELSQLMKWKLSRGKWRPRLLDFVSSLD 86 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.314 0.130 0.357 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,546,946 Number of Sequences: 28952 Number of extensions: 49598 Number of successful extensions: 415 Number of sequences better than 10.0: 136 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 14 Number of HSP's that attempted gapping in prelim test: 150 Number of HSP's gapped (non-prelim): 279 length of query: 72 length of database: 12,070,560 effective HSP length: 52 effective length of query: 20 effective length of database: 10,565,056 effective search space: 211301120 effective search space used: 211301120 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -