BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001318-TA|BGIBMGA001318-PA|IPR002048|Calcium-binding EF-hand (72 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36414| Best HMM Match : No HMM Matches (HMM E-Value=.) 121 1e-28 SB_49196| Best HMM Match : efhand (HMM E-Value=3.4e-39) 100 2e-22 SB_44952| Best HMM Match : efhand (HMM E-Value=3.4e-39) 100 2e-22 SB_21457| Best HMM Match : efhand (HMM E-Value=1.7e-29) 87 2e-18 SB_15743| Best HMM Match : efhand (HMM E-Value=3.6e-07) 83 3e-17 SB_42726| Best HMM Match : efhand (HMM E-Value=6.4e-07) 80 3e-16 SB_21204| Best HMM Match : efhand (HMM E-Value=1.7e-21) 76 5e-15 SB_8146| Best HMM Match : efhand (HMM E-Value=1.2e-16) 73 4e-14 SB_644| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-13 SB_14640| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-13 SB_5690| Best HMM Match : efhand (HMM E-Value=7.39998e-41) 69 7e-13 SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) 66 5e-12 SB_50692| Best HMM Match : efhand (HMM E-Value=1.5e-15) 64 2e-11 SB_16925| Best HMM Match : efhand (HMM E-Value=3e-22) 62 5e-11 SB_23123| Best HMM Match : efhand (HMM E-Value=2.8e-07) 58 1e-09 SB_14506| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-09 SB_46583| Best HMM Match : Hus1 (HMM E-Value=0) 55 7e-09 SB_7126| Best HMM Match : efhand (HMM E-Value=2e-26) 55 7e-09 SB_8171| Best HMM Match : efhand (HMM E-Value=6.6e-12) 52 7e-08 SB_22918| Best HMM Match : efhand (HMM E-Value=2.8e-09) 52 7e-08 SB_45638| Best HMM Match : efhand (HMM E-Value=0.00028) 52 9e-08 SB_866| Best HMM Match : efhand (HMM E-Value=7.4e-18) 51 1e-07 SB_3738| Best HMM Match : efhand (HMM E-Value=8.5e-05) 51 2e-07 SB_10944| Best HMM Match : efhand (HMM E-Value=7.4e-24) 50 3e-07 SB_50111| Best HMM Match : GCC2_GCC3 (HMM E-Value=0) 48 1e-06 SB_10186| Best HMM Match : efhand (HMM E-Value=3e-14) 48 1e-06 SB_16337| Best HMM Match : efhand (HMM E-Value=3.7e-16) 46 4e-06 SB_6774| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-06 SB_45639| Best HMM Match : efhand (HMM E-Value=9.1e-08) 44 1e-05 SB_18942| Best HMM Match : efhand (HMM E-Value=1.7e-30) 43 3e-05 SB_3425| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-05 SB_2411| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 2e-04 SB_16922| Best HMM Match : DUF1647 (HMM E-Value=2e-07) 38 0.001 SB_14508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.001 SB_10943| Best HMM Match : efhand (HMM E-Value=6.4e-07) 38 0.001 SB_28847| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.002 SB_30167| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.004 SB_57582| Best HMM Match : efhand (HMM E-Value=3.8e-05) 35 0.011 SB_13634| Best HMM Match : efhand (HMM E-Value=2e-24) 35 0.011 SB_2585| Best HMM Match : COX7C (HMM E-Value=2.4) 34 0.014 SB_23574| Best HMM Match : efhand (HMM E-Value=2e-05) 34 0.014 SB_3800| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.025 SB_3224| Best HMM Match : efhand (HMM E-Value=0.00096) 33 0.025 SB_59191| Best HMM Match : efhand (HMM E-Value=1.6e-14) 33 0.033 SB_11074| Best HMM Match : efhand (HMM E-Value=1.79366e-43) 33 0.033 SB_27337| Best HMM Match : efhand (HMM E-Value=2.9e-21) 32 0.077 SB_17840| Best HMM Match : efhand (HMM E-Value=6.3e-18) 32 0.077 SB_37607| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-23) 31 0.13 SB_1299| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.18 SB_23227| Best HMM Match : efhand (HMM E-Value=4.8e-26) 30 0.23 SB_37032| Best HMM Match : efhand (HMM E-Value=4.7e-35) 30 0.23 SB_27027| Best HMM Match : efhand (HMM E-Value=8.7e-08) 30 0.23 SB_35284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.41 SB_10626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.41 SB_23229| Best HMM Match : efhand (HMM E-Value=6.8e-25) 29 0.54 SB_23228| Best HMM Match : efhand (HMM E-Value=6.8e-25) 29 0.54 SB_11953| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.54 SB_57699| Best HMM Match : efhand (HMM E-Value=1e-08) 29 0.54 SB_34261| Best HMM Match : efhand (HMM E-Value=5.3e-14) 29 0.72 SB_26337| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-21) 29 0.72 SB_23137| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 0.72 SB_56183| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.95 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 28 0.95 SB_55225| Best HMM Match : efhand (HMM E-Value=5.7e-12) 28 0.95 SB_51780| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.95 SB_15097| Best HMM Match : p450 (HMM E-Value=0) 28 0.95 SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.95 SB_37671| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.7 SB_22919| Best HMM Match : efhand (HMM E-Value=1.4e-09) 27 1.7 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.2 SB_50860| Best HMM Match : TPR_1 (HMM E-Value=0) 27 2.2 SB_37225| Best HMM Match : LRR_1 (HMM E-Value=2.6e-11) 27 2.9 SB_52231| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 3.8 SB_43931| Best HMM Match : efhand (HMM E-Value=0.17) 26 3.8 SB_58660| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 3.8 SB_57811| Best HMM Match : efhand (HMM E-Value=4.3e-05) 26 3.8 SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 3.8 SB_30172| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 3.8 SB_12454| Best HMM Match : efhand (HMM E-Value=0.016) 26 3.8 SB_50360| Best HMM Match : efhand (HMM E-Value=2.5e-05) 26 5.1 SB_42788| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.1 SB_18908| Best HMM Match : efhand (HMM E-Value=5.5e-31) 26 5.1 SB_10928| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.1 SB_59674| Best HMM Match : efhand (HMM E-Value=1.3e-18) 26 5.1 SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) 26 5.1 SB_44419| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.1 SB_20132| Best HMM Match : efhand (HMM E-Value=4.4e-11) 26 5.1 SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) 25 6.7 SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 6.7 SB_27812| Best HMM Match : efhand (HMM E-Value=1.7e-07) 25 6.7 SB_39543| Best HMM Match : efhand (HMM E-Value=0.00063) 25 8.8 SB_20477| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.8 SB_14048| Best HMM Match : CBF (HMM E-Value=9.6e-17) 25 8.8 SB_43892| Best HMM Match : efhand (HMM E-Value=2.3e-11) 25 8.8 SB_36462| Best HMM Match : efhand (HMM E-Value=5.8e-09) 25 8.8 SB_25627| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.8 SB_20575| Best HMM Match : TPR_1 (HMM E-Value=0) 25 8.8 SB_11617| Best HMM Match : TPR_1 (HMM E-Value=0) 25 8.8 >SB_36414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 121 bits (291), Expect = 1e-28 Identities = 58/58 (100%), Positives = 58/58 (100%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 2 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59 Score = 54.8 bits (126), Expect = 1e-08 Identities = 26/63 (41%), Positives = 38/63 (60%) Query: 1 MVVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV 60 + +MA + E +EAF +FDKDG+G I+ EL VM +LG+ T+ E+ +MI E Sbjct: 70 LTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREA 129 Query: 61 DAD 63 D D Sbjct: 130 DID 132 Score = 29.9 bits (64), Expect = 0.31 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVM-RSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E T+M R + +E E+++ D D Sbjct: 47 AELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKD 96 >SB_49196| Best HMM Match : efhand (HMM E-Value=3.4e-39) Length = 659 Score = 100 bits (239), Expect = 2e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Query: 17 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 2 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 48 Score = 55.2 bits (127), Expect = 7e-09 Identities = 26/63 (41%), Positives = 38/63 (60%) Query: 1 MVVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV 60 + +MA + E +EAF +FDKDG+G I+ EL VM +LG+ T+ E+ +MI E Sbjct: 59 LTMMARKMKNTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREA 118 Query: 61 DAD 63 D D Sbjct: 119 DID 121 Score = 29.9 bits (64), Expect = 0.31 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVM-RSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E T+M R + +E E+++ D D Sbjct: 36 AELQDMINEVDADGNGTIDFPEFLTMMARKMKNTDSEEEIREAFRVFDKD 85 >SB_44952| Best HMM Match : efhand (HMM E-Value=3.4e-39) Length = 250 Score = 100 bits (239), Expect = 2e-22 Identities = 47/47 (100%), Positives = 47/47 (100%) Query: 17 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD Sbjct: 2 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 48 Score = 55.2 bits (127), Expect = 7e-09 Identities = 26/63 (41%), Positives = 38/63 (60%) Query: 1 MVVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV 60 + +MA + E +EAF +FDKDG+G I+ EL VM +LG+ T+ E+ +MI E Sbjct: 59 LTMMARKMKNTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREA 118 Query: 61 DAD 63 D D Sbjct: 119 DID 121 Score = 29.9 bits (64), Expect = 0.31 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVM-RSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+GTI E T+M R + +E E+++ D D Sbjct: 36 AELQDMINEVDADGNGTIDFPEFLTMMARKMKNTDSEEEIREAFRVFDKD 85 >SB_21457| Best HMM Match : efhand (HMM E-Value=1.7e-29) Length = 420 Score = 87.0 bits (206), Expect = 2e-18 Identities = 40/57 (70%), Positives = 49/57 (85%) Query: 7 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 ++L+EEQ+AE KEAF+LFDKDG G+I++ EL VMRSLGQNPTE EL+DMI EVD D Sbjct: 282 EKLSEEQVAELKEAFALFDKDGGGSISSSELAHVMRSLGQNPTEQELKDMIAEVDQD 338 Score = 53.6 bits (123), Expect = 2e-08 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 3/54 (5%) Query: 10 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 TEE+I ++AF +FDK+GDG I++ EL VM +LG+ T+ E+ +MI E D D Sbjct: 361 TEEEI---QDAFKVFDKNGDGMISSSELKLVMSNLGERLTDDEVDEMIREADID 411 >SB_15743| Best HMM Match : efhand (HMM E-Value=3.6e-07) Length = 97 Score = 83.0 bits (196), Expect = 3e-17 Identities = 35/52 (67%), Positives = 45/52 (86%) Query: 12 EQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + I+++++AF FDKDG+G ITT+ELG +MRSLGQNPTE ELQDM+NEVD D Sbjct: 45 DNISKYRDAFKFFDKDGNGHITTRELGAIMRSLGQNPTENELQDMVNEVDYD 96 >SB_42726| Best HMM Match : efhand (HMM E-Value=6.4e-07) Length = 49 Score = 79.8 bits (188), Expect = 3e-16 Identities = 34/47 (72%), Positives = 41/47 (87%) Query: 17 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +++AF FDKDG+G ITT+ELG +MRSLGQNPTE ELQDM+NEVD D Sbjct: 2 YRDAFKFFDKDGNGHITTRELGAIMRSLGQNPTENELQDMVNEVDYD 48 >SB_21204| Best HMM Match : efhand (HMM E-Value=1.7e-21) Length = 202 Score = 75.8 bits (178), Expect = 5e-15 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 2/62 (3%) Query: 4 MAADQLTEEQIA--EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 MA + + + I ++++AF FDKD G+ITT+ELG +MRSLG+NPTE ELQDMIN VD Sbjct: 37 MALENIWQNHIKWRKYRDAFEHFDKDSSGSITTRELGGIMRSLGENPTEIELQDMINSVD 96 Query: 62 AD 63 D Sbjct: 97 CD 98 Score = 38.7 bits (86), Expect = 7e-04 Identities = 16/41 (39%), Positives = 27/41 (65%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE 59 EAF +FD+DG G + + +L V+R L +N E E+ D++ + Sbjct: 127 EAFRMFDRDGRGYVMSSDLRFVLRHLEENIPEHEINDILQD 167 >SB_8146| Best HMM Match : efhand (HMM E-Value=1.2e-16) Length = 285 Score = 72.5 bits (170), Expect = 4e-14 Identities = 32/55 (58%), Positives = 45/55 (81%) Query: 7 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 ++L++ QIAE+KEAF++FD D +GTI + ELG+VMR+LGQNPTE ++DMI D Sbjct: 2 EKLSKAQIAEYKEAFNMFDNDRNGTICSHELGSVMRALGQNPTEDMIRDMIASAD 56 Score = 39.5 bits (88), Expect = 4e-04 Identities = 19/48 (39%), Positives = 28/48 (58%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E + AF DKDGDG IT +L M+ +N ++ +L+ MI + D D Sbjct: 74 EIRMAFKSMDKDGDGFITFGDLKKTMQECDENLSDDDLKRMIIDADLD 121 >SB_644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 70.9 bits (166), Expect = 1e-13 Identities = 33/58 (56%), Positives = 41/58 (70%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A +TEEQI EFK AF FDK+GDG I +ELG VMRS+G +P + EL+ MI + D D Sbjct: 6 ATDITEEQIREFKNAFMSFDKNGDGRIDAEELGIVMRSIGLHPKDEELKAMIKQADKD 63 Score = 52.4 bits (120), Expect = 5e-08 Identities = 23/61 (37%), Positives = 39/61 (63%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA+ + ++ +EAFSLFDKDG+G I+ +E+ V+ +G N TE E +++ + D Sbjct: 205 LMASKSKNDTTESDLREAFSLFDKDGNGLISAQEMKFVLTCMGFNITEKEAVELVKQADI 264 Query: 63 D 63 D Sbjct: 265 D 265 Score = 51.6 bits (118), Expect = 9e-08 Identities = 23/61 (37%), Positives = 38/61 (62%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +MA+ + ++ +EAFSLFDKDG+G I+ +E+ V +G N TE E +++ + D Sbjct: 76 LMASKSKNDTTESDLREAFSLFDKDGNGLISAQEMKFVFTCMGFNITEKEAVELVKQADM 135 Query: 63 D 63 D Sbjct: 136 D 136 Score = 50.4 bits (115), Expect = 2e-07 Identities = 24/48 (50%), Positives = 31/48 (64%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 EFK AF FDK+ DG I +EL V RS+G +P + EL+ MI + D D Sbjct: 145 EFKNAFMSFDKNVDGRIDAEELEIVTRSIGLHPKDEELKAMIKQADKD 192 Score = 29.1 bits (62), Expect = 0.54 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQN-PTEAELQDMINEVDAD 63 E K DKDG G I E +M S +N TE++L++ + D D Sbjct: 52 ELKAMIKQADKDGSGDIDLPEFIELMASKSKNDTTESDLREAFSLFDKD 100 Score = 29.1 bits (62), Expect = 0.54 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQN-PTEAELQDMINEVDAD 63 E K DKDG G I E +M S +N TE++L++ + D D Sbjct: 181 ELKAMIKQADKDGSGDIDLPEFIELMASKSKNDTTESDLREAFSLFDKD 229 >SB_14640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 70.5 bits (165), Expect = 2e-13 Identities = 30/49 (61%), Positives = 39/49 (79%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A++KEAF ++D DG G +TTKEL MR+LG NPTE E+Q+M+NEVD D Sbjct: 148 AQYKEAFHMYDADGSGHVTTKELHKAMRTLGFNPTEEEIQEMVNEVDYD 196 Score = 33.1 bits (72), Expect = 0.033 Identities = 18/61 (29%), Positives = 29/61 (47%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 +M + +E+ + AF +FD D G I EL ++ + + E ELQDM+ Sbjct: 209 LMENQKKPDEEEQDLINAFHVFDSDDKGYIEASELRDLLCGMEKKIPEDELQDMLRYYGL 268 Query: 63 D 63 D Sbjct: 269 D 269 >SB_5690| Best HMM Match : efhand (HMM E-Value=7.39998e-41) Length = 153 Score = 68.5 bits (160), Expect = 7e-13 Identities = 31/43 (72%), Positives = 36/43 (83%) Query: 21 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 FSLFDKDG GTI+ +EL VM+SLGQNP++ ELQ MI EVDAD Sbjct: 6 FSLFDKDGSGTISNEELEVVMKSLGQNPSDEELQQMIQEVDAD 48 Score = 53.6 bits (123), Expect = 2e-08 Identities = 23/49 (46%), Positives = 37/49 (75%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AE +EAF +FD++GDG+I+ EL +VM SLG+ ++ E+++M+ E D D Sbjct: 73 AEMREAFRVFDRNGDGSISEWELRSVMASLGEKLSDDEIKEMMREADLD 121 >SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) Length = 354 Score = 65.7 bits (153), Expect = 5e-12 Identities = 30/53 (56%), Positives = 39/53 (73%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV 60 +LTE Q+ E KEAF +FD +GDG IT EL ++ SLG N TEAEL DM+N++ Sbjct: 205 ELTESQVREIKEAFLVFDDNGDGCITATELKKLVTSLGYNITEAELMDMMNQI 257 Score = 35.5 bits (78), Expect = 0.006 Identities = 15/46 (32%), Positives = 29/46 (63%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +E F +FD+D + +I +E+ V++ LGQ+ + E++ M+ D D Sbjct: 293 QETFRVFDRDNNNSIGVEEVQRVLKLLGQDFKDYEVEAMLQGADYD 338 >SB_50692| Best HMM Match : efhand (HMM E-Value=1.5e-15) Length = 150 Score = 63.7 bits (148), Expect = 2e-11 Identities = 26/58 (44%), Positives = 42/58 (72%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A LT++ I + +E+F L+DK GD I + +LG V+R LGQNPT AE++ +++E+D + Sbjct: 2 AKNLTDKDIRQLRESFELYDKQGDEKIDSSQLGEVLRGLGQNPTNAEVKKIVSEMDPE 59 Score = 35.9 bits (79), Expect = 0.005 Identities = 14/46 (30%), Positives = 28/46 (60%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 +F ++ +FD DG G I EL ++ +LG+ T++E+ +I ++ Sbjct: 87 DFVDSLRVFDNDGSGMINEGELRHILTTLGEKLTDSEVDSLIQGLE 132 >SB_16925| Best HMM Match : efhand (HMM E-Value=3e-22) Length = 132 Score = 62.5 bits (145), Expect = 5e-11 Identities = 27/55 (49%), Positives = 38/55 (69%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWRY 70 E ++ FS+FDKD G+I T EL VMR LG+NP++ E+QDMI + D D + R+ Sbjct: 4 EMRDVFSMFDKDNSGSIDTDELRDVMRELGENPSDKEIQDMIADADKDGSGEIRF 58 Score = 32.7 bits (71), Expect = 0.044 Identities = 16/58 (27%), Positives = 31/58 (53%) Query: 7 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADA 64 +QL AE +AF+ +DK+G G I KEL +++ + + ++ M+ D ++ Sbjct: 67 NQLRAGSEAEIMDAFNAWDKEGRGDIQVKELRSMLMRIPERLQRKDVDKMLAIADPNS 124 Score = 27.1 bits (57), Expect = 2.2 Identities = 14/48 (29%), Positives = 24/48 (50%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E ++ + DKDG G I + +M + + +EAE+ D N D + Sbjct: 40 EIQDMIADADKDGSGEIRFAQFMQLMNNQLRAGSEAEIMDAFNAWDKE 87 >SB_23123| Best HMM Match : efhand (HMM E-Value=2.8e-07) Length = 50 Score = 57.6 bits (133), Expect = 1e-09 Identities = 26/47 (55%), Positives = 33/47 (70%) Query: 17 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 FK AF FDK+GDG I +ELG VMRS+G +P + EL+ MI + D D Sbjct: 2 FKNAFMSFDKNGDGRIDAEELGIVMRSIGLHPKDEELKAMIKQADKD 48 >SB_14506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 57.2 bits (132), Expect = 2e-09 Identities = 27/66 (40%), Positives = 42/66 (63%) Query: 5 AADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADA 64 AA + EQI EF++AFS+++KDG I T + ++RSLG NP E E+ + +NE+ A Sbjct: 217 AAKLFSREQIEEFEDAFSVYNKDGSDNIKTTLVFNLIRSLGHNPPEHEVWEYLNELGLTA 276 Query: 65 YEKWRY 70 K ++ Sbjct: 277 NSKLKF 282 >SB_46583| Best HMM Match : Hus1 (HMM E-Value=0) Length = 646 Score = 55.2 bits (127), Expect = 7e-09 Identities = 24/46 (52%), Positives = 35/46 (76%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 E++EAFSLFD+ GDG I ++G ++RSLG NPT AE++ + +VD Sbjct: 515 EYREAFSLFDRVGDGKIECDQIGCLLRSLGLNPTGAEVKKIEKDVD 560 Score = 41.1 bits (92), Expect = 1e-04 Identities = 18/46 (39%), Positives = 28/46 (60%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 EF E +FD+DG GT+ EL +V+ SLG+ ++ E+ + VD Sbjct: 590 EFVEGLRVFDRDGTGTVLAAELRSVLMSLGEKLSDEEVTTLFAPVD 635 >SB_7126| Best HMM Match : efhand (HMM E-Value=2e-26) Length = 213 Score = 55.2 bits (127), Expect = 7e-09 Identities = 26/63 (41%), Positives = 40/63 (63%) Query: 1 MVVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV 60 + +MA ++ E +EAF +FDKDG+G I+ EL VM +LG+ T+ E+++MI E Sbjct: 34 LTMMAKKMGEQDSDEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVEEMIMEA 93 Query: 61 DAD 63 D D Sbjct: 94 DID 96 Score = 50.8 bits (116), Expect = 2e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Query: 41 MRSLGQNPTEAELQDMINEVDAD 63 MRSLGQNPTEAELQDMINEVDAD Sbjct: 1 MRSLGQNPTEAELQDMINEVDAD 23 Score = 29.1 bits (62), Expect = 0.54 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVM-RSLGQNPTEAELQDMINEVDAD 63 AE ++ + D DG+G I E T+M + +G+ ++ E+++ D D Sbjct: 11 AELQDMINEVDADGNGIIDFPEFLTMMAKKMGEQDSDEEIREAFRVFDKD 60 >SB_8171| Best HMM Match : efhand (HMM E-Value=6.6e-12) Length = 77 Score = 52.0 bits (119), Expect = 7e-08 Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 +LTEEQ+ + KE+F FD D +G IT KELG V + G +++++I+E D D Sbjct: 10 ELTEEQLGDLKESFDEFDVDHNGHITVKELGAVFSAAGAEVPGYKVREVISEYDKD 65 >SB_22918| Best HMM Match : efhand (HMM E-Value=2.8e-09) Length = 231 Score = 52.0 bits (119), Expect = 7e-08 Identities = 23/48 (47%), Positives = 32/48 (66%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E + AF ++D +GDG I+ +ELG MR GQ ++ EL+DMI VD D Sbjct: 165 EIEAAFKMYDTNGDGQISAEELGQAMREAGQLVSDEELKDMIRAVDLD 212 >SB_45638| Best HMM Match : efhand (HMM E-Value=0.00028) Length = 146 Score = 51.6 bits (118), Expect = 9e-08 Identities = 24/59 (40%), Positives = 38/59 (64%), Gaps = 4/59 (6%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWR 69 EEQ+ EF++ F LFD+ GDG I ++G ++R++G NP + E + +V+AD K R Sbjct: 5 EEQLTEFRDGFMLFDQIGDGNINYDQIGKMLRAMGLNPIDGE----VKKVEADFKTKER 59 >SB_866| Best HMM Match : efhand (HMM E-Value=7.4e-18) Length = 171 Score = 51.2 bits (117), Expect = 1e-07 Identities = 21/49 (42%), Positives = 36/49 (73%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE 59 + QI EFKEAF++ D++ DG I ++L ++ SLG++PT+ L++M+ E Sbjct: 27 QSQIQEFKEAFNMIDQNHDGFIDKEDLHDMLASLGKDPTDGYLEEMVKE 75 Score = 33.5 bits (73), Expect = 0.025 Identities = 14/46 (30%), Positives = 26/46 (56%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + AF+ FD+DG+G I L M S+G ++ ++ D++ + D Sbjct: 103 RNAFACFDEDGNGRIHEDLLKEAMMSMGDRFSDEQVDDILRDAPID 148 >SB_3738| Best HMM Match : efhand (HMM E-Value=8.5e-05) Length = 447 Score = 50.8 bits (116), Expect = 2e-07 Identities = 23/55 (41%), Positives = 34/55 (61%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 LT EQ+ FKE F LFD +G GTI +EL +RS+ T+ E+ +++ +D D Sbjct: 54 LTSEQVMAFKEVFDLFDSNGGGTIDAEELDLALRSVDIQLTQEEIVEVLMAMDKD 108 >SB_10944| Best HMM Match : efhand (HMM E-Value=7.4e-24) Length = 127 Score = 50.0 bits (114), Expect = 3e-07 Identities = 24/48 (50%), Positives = 31/48 (64%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E +AF LFD D G I+ K L V + LG+N T+ ELQ+MI+E D D Sbjct: 60 EILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRD 107 Score = 44.0 bits (99), Expect = 2e-05 Identities = 20/30 (66%), Positives = 22/30 (73%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKEL 37 +LTEEQ E +EAF LFD DG GTI KEL Sbjct: 22 ELTEEQKQEIREAFDLFDTDGSGTIDAKEL 51 >SB_50111| Best HMM Match : GCC2_GCC3 (HMM E-Value=0) Length = 1115 Score = 48.0 bits (109), Expect = 1e-06 Identities = 26/61 (42%), Positives = 34/61 (55%) Query: 3 VMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 VM L + E +AF LFD D G I+ + L V R LG+N T+ EL+ MI+E D Sbjct: 90 VMTDWMLDRDPQEEVFKAFRLFDDDDSGKISLRNLRRVARELGENMTDEELRAMIDEFDK 149 Query: 63 D 63 D Sbjct: 150 D 150 Score = 46.0 bits (104), Expect = 4e-06 Identities = 24/60 (40%), Positives = 36/60 (60%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEK 67 +L EEQ E KEAF+LFD D D I EL MR+LG + +A++ ++ + D ++ K Sbjct: 22 ELGEEQRQEIKEAFNLFDTDKDQAIDYHELKVAMRALGFDVKKADVLKIMKDYDRESTGK 81 >SB_10186| Best HMM Match : efhand (HMM E-Value=3e-14) Length = 133 Score = 48.0 bits (109), Expect = 1e-06 Identities = 22/49 (44%), Positives = 33/49 (67%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE 59 + QI EFKEAF++ D++ DG I ++L + SLG++P + L DMI E Sbjct: 27 QTQIQEFKEAFNMIDQNRDGFIDKEDLKDMYASLGKSPNDQFLDDMIEE 75 Score = 28.3 bits (60), Expect = 0.95 Identities = 12/28 (42%), Positives = 18/28 (64%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLG 45 K AF FD++GDG I +L ++ S+G Sbjct: 104 KNAFGCFDEEGDGRIHEDKLCDMLTSVG 131 >SB_16337| Best HMM Match : efhand (HMM E-Value=3.7e-16) Length = 168 Score = 46.0 bits (104), Expect = 4e-06 Identities = 21/49 (42%), Positives = 32/49 (65%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE 59 + QI EFKEAF++ D++ DG I +L V SLG+ + ++DM+NE Sbjct: 26 QSQIQEFKEAFNMIDQNRDGFIDKNDLKAVFDSLGKLVNDEYVEDMLNE 74 Score = 31.5 bits (68), Expect = 0.10 Identities = 14/42 (33%), Positives = 24/42 (57%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE 59 + AF FD +G G+I ++L + S+ T E +DM++E Sbjct: 102 RNAFGSFDLEGKGSIDEEKLKRLCMSMSDRMTAEEWEDMMDE 143 >SB_6774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 46.0 bits (104), Expect = 4e-06 Identities = 24/60 (40%), Positives = 36/60 (60%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEK 67 +L EEQ E KEAF+LFD D D I EL MR+LG + +A++ ++ + D ++ K Sbjct: 22 ELGEEQRQEIKEAFNLFDTDKDQAIDYHELKVAMRALGFDVKKADVLKIMKDYDRESTGK 81 >SB_45639| Best HMM Match : efhand (HMM E-Value=9.1e-08) Length = 144 Score = 44.4 bits (100), Expect = 1e-05 Identities = 21/40 (52%), Positives = 27/40 (67%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNP 48 L +EQI E K+AFSLFDK G G I + V+R++G NP Sbjct: 4 LNDEQIGELKDAFSLFDKTGKGYIDADIVIDVLRAVGLNP 43 Score = 30.3 bits (65), Expect = 0.23 Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPT 49 EF E FD + DGT+++ +L ++ SLG T Sbjct: 82 EFIEGLRAFDNNSDGTMSSAQLRNLLTSLGDTLT 115 >SB_18942| Best HMM Match : efhand (HMM E-Value=1.7e-30) Length = 233 Score = 43.2 bits (97), Expect = 3e-05 Identities = 22/59 (37%), Positives = 33/59 (55%) Query: 5 AADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 A LT ++I + K F FD D G+I +EL MR+LG ++ + MI ++DAD Sbjct: 80 AYQHLTPQEIRDLKLVFDTFDTDKSGSIDGRELRKAMRTLGFKISKEGIAGMIADLDAD 138 Score = 39.9 bits (89), Expect = 3e-04 Identities = 20/48 (41%), Positives = 25/48 (52%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 E + F +FD D G IT + L V R G E EL++MI E D D Sbjct: 165 EIVQGFKMFDTDQSGRITLENLKQVSRMCGVKLNETELKEMILEADKD 212 >SB_3425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 43.2 bits (97), Expect = 3e-05 Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Query: 12 EQIAE-FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWRY 70 E++ E ++AF +FD++GDG I+ +EL + +LG T+ E +++I +D D K Y Sbjct: 213 EKLEENLRQAFRVFDRNGDGYISAEELRVAVTTLGDALTQDEAEELIGMLDQDGDGKLGY 272 Score = 33.9 bits (74), Expect = 0.019 Identities = 13/36 (36%), Positives = 24/36 (66%) Query: 26 KDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 ++ DGTI E G V++++G PT +++ D++N D Sbjct: 153 RNKDGTIDHTEFGRVLQAIGYTPTISQILDILNAFD 188 Score = 25.8 bits (54), Expect = 5.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 14 IAEFKEAFSLFDKDGDGTITTKELGTVMR 42 I++ + + FDK+GDG I E T+ R Sbjct: 177 ISQILDILNAFDKNGDGAIDFDEFVTMSR 205 >SB_2411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 660 Score = 40.7 bits (91), Expect = 2e-04 Identities = 19/47 (40%), Positives = 27/47 (57%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQD 55 +TEEQ+ EF+ +F+ FDKD G + E + SLG N E + D Sbjct: 511 ITEEQMKEFRASFNFFDKDQTGKLEPNEFKQCLVSLGYNIKEGDKGD 557 >SB_16922| Best HMM Match : DUF1647 (HMM E-Value=2e-07) Length = 422 Score = 37.9 bits (84), Expect = 0.001 Identities = 18/51 (35%), Positives = 27/51 (52%) Query: 4 MAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQ 54 MA + E K+ F L+D G I LG V+R+ G NPT++E++ Sbjct: 269 MATKNMIERDEQLLKDIFDLYDTTGSEKIDVGYLGQVLRAAGLNPTQSEVR 319 >SB_14508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1392 Score = 37.9 bits (84), Expect = 0.001 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Query: 6 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN 58 +DQ +E+I EFK AF ++ + D I TK L V +SLG N T +L +I+ Sbjct: 727 SDQFPDEKIQEFKIAFEMYCRK-DYKIPTKALPRVCKSLGYNYTLQDLDYLIS 778 >SB_10943| Best HMM Match : efhand (HMM E-Value=6.4e-07) Length = 154 Score = 37.9 bits (84), Expect = 0.001 Identities = 18/51 (35%), Positives = 27/51 (52%) Query: 4 MAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQ 54 MA + E K+ F L+D G I LG V+R+ G NPT++E++ Sbjct: 1 MATKNMIERDEQLLKDIFDLYDTTGSEKIDVGYLGQVLRAAGLNPTQSEVR 51 >SB_28847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 37.5 bits (83), Expect = 0.002 Identities = 19/45 (42%), Positives = 25/45 (55%) Query: 17 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 +K+ F +D + G I EL +M LGQ T EL+ MI EVD Sbjct: 45 YKKQFMEYDVNNSGDIDIMELKMMMEKLGQAKTHLELKKMIAEVD 89 >SB_30167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 36.3 bits (80), Expect = 0.004 Identities = 16/44 (36%), Positives = 26/44 (59%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE 59 E EAF FD D G I + E+ V+R +G+N E ++ D++ + Sbjct: 14 ELLEAFRTFDGDDKGYIFSNEIRYVLRHMGENIPEHDINDILKD 57 >SB_57582| Best HMM Match : efhand (HMM E-Value=3.8e-05) Length = 520 Score = 34.7 bits (76), Expect = 0.011 Identities = 16/45 (35%), Positives = 27/45 (60%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + F+ DKD + +T E ++RS G TE++L+D+I +D D Sbjct: 188 DLFAQADKDKNWVVTRVEFRNIIRSTGIPITESDLEDLIMALDRD 232 >SB_13634| Best HMM Match : efhand (HMM E-Value=2e-24) Length = 176 Score = 34.7 bits (76), Expect = 0.011 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTVMRSL-GQNPTEAELQDMINEVDADA 64 ++ K AF ++D D DG I+ EL V++ + G N E +LQ ++++ +A Sbjct: 111 SKLKFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKETQLQQIVDKTILNA 161 >SB_2585| Best HMM Match : COX7C (HMM E-Value=2.4) Length = 193 Score = 34.3 bits (75), Expect = 0.014 Identities = 18/41 (43%), Positives = 22/41 (53%) Query: 21 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 F +D D G I +L VM LGQ T EL+ MI E+D Sbjct: 3 FMEYDTDCSGEIDIVKLKLVMEKLGQAKTHLELKKMIAEID 43 >SB_23574| Best HMM Match : efhand (HMM E-Value=2e-05) Length = 69 Score = 34.3 bits (75), Expect = 0.014 Identities = 14/41 (34%), Positives = 26/41 (63%) Query: 17 FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI 57 F E F +FD++G+G I EL ++ SLG ++ E+ +++ Sbjct: 7 FMECFKVFDRNGNGLIGAAELRHLLASLGDKLSDEEVDNLM 47 >SB_3800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.025 Identities = 14/43 (32%), Positives = 27/43 (62%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN 58 + +AF + D+D G +TT+EL M G+ T+ E+++M++ Sbjct: 63 QLSKAFEVLDQDKKGYLTTEELTKYMTEEGEAFTQEEVEEMLS 105 >SB_3224| Best HMM Match : efhand (HMM E-Value=0.00096) Length = 322 Score = 33.5 bits (73), Expect = 0.025 Identities = 14/44 (31%), Positives = 26/44 (59%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 AFS D GDG ++ K L ++ ++GQ +++ + ++V AD Sbjct: 231 AFSCLDDGGDGKLSAKMLRELLTTMGQRMKYSDVTQLFDDVGAD 274 >SB_59191| Best HMM Match : efhand (HMM E-Value=1.6e-14) Length = 227 Score = 33.1 bits (72), Expect = 0.033 Identities = 13/50 (26%), Positives = 27/50 (54%) Query: 12 EQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 + K+AF +FD + DG IT ++ ++ S TE + +++ ++D Sbjct: 156 DSFTSVKQAFLVFDDNKDGRITRRDFRRILESFCFRMTEEQFHELMAKID 205 >SB_11074| Best HMM Match : efhand (HMM E-Value=1.79366e-43) Length = 779 Score = 33.1 bits (72), Expect = 0.033 Identities = 13/50 (26%), Positives = 27/50 (54%) Query: 12 EQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 + K+AF +FD + DG IT ++ ++ S TE + +++ ++D Sbjct: 456 DSFTSVKQAFLVFDDNKDGRITRRDFRRILESFCFRMTEEQFHELMAKID 505 >SB_27337| Best HMM Match : efhand (HMM E-Value=2.9e-21) Length = 172 Score = 31.9 bits (69), Expect = 0.077 Identities = 15/50 (30%), Positives = 24/50 (48%) Query: 14 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 I F AF +FD DG+ + E M+ G T+ E++ + + D D Sbjct: 37 IKMFGRAFRIFDDDGNRALNIDEFRKGMQDFGTKLTDDEVKQLFAQFDKD 86 Score = 29.9 bits (64), Expect = 0.31 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 16 EFKEAFSLFDKDGDGTITTKE-LGTVMRSLGQNPTE 50 E K+ F+ FDKDG G++ +E L V S+ +N E Sbjct: 75 EVKQLFAQFDKDGSGSLDFEEFLRAVRPSMSKNRVE 110 >SB_17840| Best HMM Match : efhand (HMM E-Value=6.3e-18) Length = 162 Score = 31.9 bits (69), Expect = 0.077 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMR-SLGQNPTEAELQDMINEVDAD 63 + F+ +D +G G + KE+ +++ LG NP + EL ++ + D D Sbjct: 18 RSLFNKYDVNGSGYLEEKEVRYLLQVDLGMNPDQTELYSLLLDEDGD 64 >SB_37607| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-23) Length = 267 Score = 31.1 bits (67), Expect = 0.13 Identities = 13/23 (56%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Query: 39 TVMRSLG-QNPTEAELQDMINEV 60 T+ R LG +NPTE+EL+D+ NE+ Sbjct: 85 TIERQLGSENPTESELRDLCNEI 107 >SB_1299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 30.7 bits (66), Expect = 0.18 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 8 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSL-GQNPTEAELQDMINEVDAD 63 ++++EQ +AF L DK G + +L L G P+ E+Q+++N+ + D Sbjct: 4 RISQEQKTNILQAFQLADKTSKGYLDKHDLKVAFVYLFGYKPSSYEVQELMNKSNDD 60 >SB_23227| Best HMM Match : efhand (HMM E-Value=4.8e-26) Length = 776 Score = 30.3 bits (65), Expect = 0.23 Identities = 15/46 (32%), Positives = 22/46 (47%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + F FDK+GDGTI +E + + E +L+ N D D Sbjct: 66 EHVFRTFDKNGDGTIDFREFICALSVTSRGKLEQKLKWAFNMYDLD 111 Score = 26.2 bits (55), Expect = 3.8 Identities = 9/29 (31%), Positives = 22/29 (75%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSL 44 + K AF+++D DG+G I+ +E+ +++++ Sbjct: 100 KLKWAFNMYDLDGNGYISRQEMLEIVQAI 128 >SB_37032| Best HMM Match : efhand (HMM E-Value=4.7e-35) Length = 552 Score = 30.3 bits (65), Expect = 0.23 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Query: 2 VVMAADQLTEEQI--AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE 59 ++MA D + I A AFS FD G G ++ ++L ++ + T+ + Q ++N+ Sbjct: 158 IMMAMDIMMAMNIMMAMIVMAFSAFDSSGSGLVSKEDLHQIINAFCFIMTDKQFQVLLNQ 217 Query: 60 VDAD 63 + D Sbjct: 218 LCVD 221 Score = 25.8 bits (54), Expect = 5.1 Identities = 15/60 (25%), Positives = 24/60 (40%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWRY 70 +E E + AF DKDG G + +++ + E E + + D D K Y Sbjct: 484 QEDWKEMRRAFRAIDKDGSGLCNPLDFRQMLKRFKIDLNEEEFFHVYSFYDKDMTGKISY 543 >SB_27027| Best HMM Match : efhand (HMM E-Value=8.7e-08) Length = 103 Score = 30.3 bits (65), Expect = 0.23 Identities = 14/38 (36%), Positives = 24/38 (63%) Query: 24 FDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 FD+DG G I+ +EL V+ G+ +E E +++I+ D Sbjct: 3 FDRDGSGYISPEELRYVVCHSGEKLSEDEARELIDMFD 40 >SB_35284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.5 bits (63), Expect = 0.41 Identities = 10/25 (40%), Positives = 18/25 (72%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSL 44 AF ++D DG G ++ KE+ ++RS+ Sbjct: 107 AFEIYDSDGSGEVSKKEMLEIVRSI 131 Score = 25.0 bits (52), Expect = 8.8 Identities = 13/43 (30%), Positives = 20/43 (46%) Query: 21 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 F FDK+ DGTI E + + + E +L+ D+D Sbjct: 72 FRTFDKNNDGTIDFNEFIQGLSIISRGSKETKLRWAFEIYDSD 114 >SB_10626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 29.5 bits (63), Expect = 0.41 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 4/33 (12%) Query: 20 AFSLFDKDGDGTITTKELGTVM----RSLGQNP 48 AFS++D +GDG IT +E+ ++ R+ G NP Sbjct: 8 AFSIYDVNGDGFITKQEMFRIVDALYRTAGDNP 40 >SB_23229| Best HMM Match : efhand (HMM E-Value=6.8e-25) Length = 191 Score = 29.1 bits (62), Expect = 0.54 Identities = 11/29 (37%), Positives = 22/29 (75%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSL 44 + K AFS++D DG+G I+ +E+ ++R++ Sbjct: 100 KLKWAFSMYDLDGNGYISRQEMLEIVRAI 128 Score = 25.8 bits (54), Expect = 5.1 Identities = 13/46 (28%), Positives = 21/46 (45%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + F FD +GDGTI +E + + E +L+ + D D Sbjct: 66 EHVFRTFDANGDGTIDFREFICALSVTSRGKLEEKLKWAFSMYDLD 111 >SB_23228| Best HMM Match : efhand (HMM E-Value=6.8e-25) Length = 190 Score = 29.1 bits (62), Expect = 0.54 Identities = 11/29 (37%), Positives = 22/29 (75%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSL 44 + K AFS++D DG+G I+ +E+ ++R++ Sbjct: 100 KLKWAFSMYDLDGNGYISRQEMLEIVRAI 128 Score = 25.8 bits (54), Expect = 5.1 Identities = 13/46 (28%), Positives = 21/46 (45%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + F FD +GDGTI +E + + E +L+ + D D Sbjct: 66 EHVFRTFDANGDGTIDFREFICALSVTSRGKLEQKLKWAFSMYDLD 111 >SB_11953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 29.1 bits (62), Expect = 0.54 Identities = 12/25 (48%), Positives = 18/25 (72%) Query: 20 AFSLFDKDGDGTITTKELGTVMRSL 44 AF L+D DGDG IT +E+ ++ S+ Sbjct: 95 AFKLYDLDGDGCITKQEMLHIVDSI 119 >SB_57699| Best HMM Match : efhand (HMM E-Value=1e-08) Length = 676 Score = 29.1 bits (62), Expect = 0.54 Identities = 13/45 (28%), Positives = 26/45 (57%) Query: 19 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 + F+ FDKD ++T E T ++ +G ++ +L +I+ +D D Sbjct: 609 DLFNQFDKDNSLSVTRDEFYTGLKGIGVPMSDKDLTMLIDLLDED 653 >SB_34261| Best HMM Match : efhand (HMM E-Value=5.3e-14) Length = 148 Score = 28.7 bits (61), Expect = 0.72 Identities = 16/65 (24%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Query: 1 MVVMAADQLTEEQIAE--FKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN 58 M + +L +EQ + F+ FD D G I + V+ +P E+E++ M+ Sbjct: 67 MFLTLVRRLAKEQKEQKCLSRVFNEFDHDSKGYILPSNIRRVLIKFNIDPNESEIEHMME 126 Query: 59 EVDAD 63 D + Sbjct: 127 AADTN 131 >SB_26337| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-21) Length = 602 Score = 28.7 bits (61), Expect = 0.72 Identities = 10/20 (50%), Positives = 17/20 (85%) Query: 41 MRSLGQNPTEAELQDMINEV 60 ++ L +NPTE+EL+D+ NE+ Sbjct: 447 VKMLKENPTESELRDLCNEI 466 >SB_23137| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1022 Score = 28.7 bits (61), Expect = 0.72 Identities = 10/20 (50%), Positives = 17/20 (85%) Query: 41 MRSLGQNPTEAELQDMINEV 60 ++ L +NPTE+EL+D+ NE+ Sbjct: 657 VKMLKENPTESELRDLCNEI 676 >SB_56183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 28.3 bits (60), Expect = 0.95 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAE-LQDMINEVDAD 63 + + AF +DKD G I EL T P E E L+ +++ DAD Sbjct: 326 DLRAAFEHYDKDKSGKICLDELTTTCTQFNL-PVEPELLESLLHYCDAD 373 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 28.3 bits (60), Expect = 0.95 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV-DAD 63 E +I FK+ ++ K+ DG +T KE G V S ++P +A M +EV D D Sbjct: 964 ELEIESFKDEVAVLKKELDGIVTEKE-GIVQSS--RSPVDAVPGPMCSEVTDGD 1014 >SB_55225| Best HMM Match : efhand (HMM E-Value=5.7e-12) Length = 828 Score = 28.3 bits (60), Expect = 0.95 Identities = 12/29 (41%), Positives = 18/29 (62%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKEL 37 + +Q A FK F DKD +G++T +EL Sbjct: 321 INSKQQAAFKSMFQEVDKDKNGSVTLEEL 349 Score = 25.8 bits (54), Expect = 5.1 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Query: 12 EQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWRYI 71 + I FKE + + D+D D + EL VM S G + V A +++ YI Sbjct: 430 QHIVIFKEMYKIMDEDDDNRLDANEL-LVMVSAGMETEIGADLEQAKAVLEGARDEFGYI 488 >SB_51780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 28.3 bits (60), Expect = 0.95 Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 17 FKEAFSLFDKDGDGTITTKELGTVMRSLGQN 47 ++ AF DKD DG IT +EL + G N Sbjct: 460 YRSAFEELDKDEDGEITFQELMAFIEKKGVN 490 >SB_15097| Best HMM Match : p450 (HMM E-Value=0) Length = 1310 Score = 28.3 bits (60), Expect = 0.95 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 17 FKEAFSLFDKDGDGTITTKELGTVMRSL 44 F+ AF +FD +GDG + +KE V L Sbjct: 195 FEIAFQMFDLNGDGEVDSKEFEKVQNIL 222 >SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 28.3 bits (60), Expect = 0.95 Identities = 15/46 (32%), Positives = 20/46 (43%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 E K F FD DG GTI E +R + +Q N++D Sbjct: 79 EVKRTFEAFDTDGSGTIDFDEFLIRLRPPMSKARKNVIQQAFNKLD 124 >SB_37671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 27.5 bits (58), Expect = 1.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 7 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGT 39 D+ T+EQ+AE + F D +GDG + E T Sbjct: 630 DKATKEQMAEDEAKFKYADVNGDGMLDLHEYVT 662 >SB_22919| Best HMM Match : efhand (HMM E-Value=1.4e-09) Length = 117 Score = 27.5 bits (58), Expect = 1.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI 57 K F FD+DG+G I + E+ ++R+ N T L+ + Sbjct: 2 KAYFDRFDQDGNGFIDSDEIKFLVRAFYSNLTGDALKQQV 41 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 27.1 bits (57), Expect = 2.2 Identities = 13/44 (29%), Positives = 19/44 (43%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVD 61 K F L DK+GDG + EL + + E +I+ D Sbjct: 1502 KREFKLMDKNGDGVVKLDELALYLDPRNEQHAANEASYLISVAD 1545 >SB_50860| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 933 Score = 27.1 bits (57), Expect = 2.2 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKE---LGTVMRSLGQ 46 E+ + FK A SLF K GD + K +G+V RS G+ Sbjct: 372 EDAMNSFKNALSLFQKTGDESGQAKAYLGMGSVHRSHGK 410 Score = 25.0 bits (52), Expect = 8.8 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Query: 17 FKEAFSLFDKDGDGTITTKE---LGTVMRSLGQ 46 FK A SLF K GD + K +G+V RS G+ Sbjct: 218 FKHALSLFQKTGDESGQAKAYHGMGSVHRSHGK 250 >SB_37225| Best HMM Match : LRR_1 (HMM E-Value=2.6e-11) Length = 497 Score = 26.6 bits (56), Expect = 2.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Query: 15 AEFKEAFSLFDKDGDGTITTKELGTV 40 ++ K +L DKDGDG I E V Sbjct: 470 SQLKRLITLLDKDGDGMIDYSEFAAV 495 >SB_52231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 432 Score = 26.2 bits (55), Expect = 3.8 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 25 DKDGDGTITTKELGTVMRSLGQNPTEAE-LQDMINEV 60 D DGDG + EL + + +P + + LQD+ N V Sbjct: 84 DADGDGILNDTELNSFQKRCFNSPLQGQGLQDVKNVV 120 >SB_43931| Best HMM Match : efhand (HMM E-Value=0.17) Length = 204 Score = 26.2 bits (55), Expect = 3.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Query: 16 EFKEAFSLFDKDGDGTITTKELGT 39 + K AF+L+D D DG IT + + T Sbjct: 161 KLKWAFNLYDLDSDGVITRELMDT 184 >SB_58660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 960 Score = 26.2 bits (55), Expect = 3.8 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 17 FKEAFSLFDKDGDGTITTKELGTVMRSL-GQNPTEAELQDMINEVDADAYEK 67 F+ F+ DKD DG I +EL +R L Q+ T ++ ++ ++ + K Sbjct: 314 FRHYFTKNDKDKDGFINHRELLKALRDLYAQSITVEQVNAILGMLEIEEMSK 365 >SB_57811| Best HMM Match : efhand (HMM E-Value=4.3e-05) Length = 70 Score = 26.2 bits (55), Expect = 3.8 Identities = 12/45 (26%), Positives = 24/45 (53%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 ++AF D DG ++ E +V+R E E+ +++E+D+ Sbjct: 9 RKAFRKLDLQNDGYLSIPEFRSVLRLCNTVLEEDEIYHLLSELDS 53 >SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 26.2 bits (55), Expect = 3.8 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Query: 32 ITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWRYI 71 + ++ GTV G + TEA L MIN++D E W+Y+ Sbjct: 417 VDPRQFGTVP---GSSTTEA-LITMINDLDIADTELWKYV 452 >SB_30172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 701 Score = 26.2 bits (55), Expect = 3.8 Identities = 12/45 (26%), Positives = 24/45 (53%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA 62 ++AF D DG ++ E +V+R E E+ +++E+D+ Sbjct: 640 RKAFRKLDLQNDGYLSIPEFRSVLRLCNTVLEEDEIYHLLSELDS 684 >SB_12454| Best HMM Match : efhand (HMM E-Value=0.016) Length = 273 Score = 26.2 bits (55), Expect = 3.8 Identities = 12/39 (30%), Positives = 19/39 (48%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQN 47 L E Q + F FD+D DG + +EL + + +N Sbjct: 96 LNENQTNYYHRIFENFDEDNDGYLFPEELLEALECVNKN 134 >SB_50360| Best HMM Match : efhand (HMM E-Value=2.5e-05) Length = 363 Score = 25.8 bits (54), Expect = 5.1 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 7/57 (12%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWRYIM 72 +F + +D+DG G+I EL ++R + A++Q E+ D EKW+ I+ Sbjct: 43 DFSRIWDNYDQDGKGSIKGAELDALIRDV-----FAKIQGRSPEM--DDIEKWKDII 92 Score = 25.4 bits (53), Expect = 6.7 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 12 EQIAEFKEAFSLF-DKDGDGTITTKELGTVMRSLGQNPTEAELQD 55 + I ++K+ +F D DGDG I+ +EL + + G + L D Sbjct: 83 DDIEKWKDIIMMFADADGDGAISKEEL-NIFFAQGLKEAKKRLSD 126 >SB_42788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 617 Score = 25.8 bits (54), Expect = 5.1 Identities = 12/43 (27%), Positives = 21/43 (48%) Query: 2 VVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSL 44 + ++L EE++ K+ FSL+ I + GTV +L Sbjct: 487 ITKTCEKLEEERVGHLKDMFSLYGNMLAAVIPELQQGTVQSTL 529 >SB_18908| Best HMM Match : efhand (HMM E-Value=5.5e-31) Length = 156 Score = 25.8 bits (54), Expect = 5.1 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMR-SLGQNPTEAE 52 K F+ +DKDG G + E+ +++ LG + +AE Sbjct: 17 KSLFTKYDKDGSGRLQKTEMMELLKVDLGLDDKQAE 52 Score = 25.8 bits (54), Expect = 5.1 Identities = 14/57 (24%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Query: 7 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 D+ +I + E F +DKD G+I +E +M G + + + ++D D Sbjct: 86 DKSRYHKIRKAIEMFKKYDKDASGSIDREEFKQLMHETG---NKVNIDKALKKLDKD 139 >SB_10928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 25.8 bits (54), Expect = 5.1 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 8 QLTEEQIAEFKEA-FSLFDKDGDGTITTKELGTV 40 ++ E ++ EA F ++D + DGTI++KE + Sbjct: 273 RVVERHVSAMVEAVFRVYDTNKDGTISSKEFDAI 306 >SB_59674| Best HMM Match : efhand (HMM E-Value=1.3e-18) Length = 269 Score = 25.8 bits (54), Expect = 5.1 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 7/57 (12%) Query: 16 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADAYEKWRYIM 72 +F + +D+DG G+I EL ++R + A++Q E+ D EKW+ I+ Sbjct: 147 DFSRIWDNYDQDGKGSIKGAELDALIRDV-----FAKIQGRSPEM--DDIEKWKDII 196 Score = 25.4 bits (53), Expect = 6.7 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 12 EQIAEFKEAFSLF-DKDGDGTITTKELGTVMRSLGQNPTEAELQD 55 + I ++K+ +F D DGDG I+ +EL + + G + L D Sbjct: 187 DDIEKWKDIIMMFADADGDGAISKEEL-NIFFAQGLKEAKKRLSD 230 >SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) Length = 1026 Score = 25.8 bits (54), Expect = 5.1 Identities = 12/39 (30%), Positives = 21/39 (53%) Query: 4 MAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMR 42 +A + L + + K F LFD DG G+++ E V++ Sbjct: 753 VAFEALLRDPDSHHKLIFQLFDLDGKGSVSYDEFRNVIQ 791 >SB_44419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 25.8 bits (54), Expect = 5.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 56 MINEVDADAYEKWRYI 71 MINE+D D E W+Y+ Sbjct: 71 MINELDLDDTELWKYV 86 >SB_20132| Best HMM Match : efhand (HMM E-Value=4.4e-11) Length = 125 Score = 25.8 bits (54), Expect = 5.1 Identities = 13/50 (26%), Positives = 23/50 (46%) Query: 14 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD 63 I + + + FD + DG I EL V+ LG + + +++D D Sbjct: 21 IIDLRLQYQTFDINQDGVIDFSELMQVLDDLGDRSDVSVREAYFHQIDMD 70 >SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) Length = 893 Score = 25.4 bits (53), Expect = 6.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Query: 37 LGTVMRSLGQNPTEAELQDMINEV 60 LG + L PTE E Q +INEV Sbjct: 53 LGLKVVDLSNQPTEKETQALINEV 76 >SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 25.4 bits (53), Expect = 6.7 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Query: 18 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQD 55 K F + DK+ DG + KEL +++ N T AE+++ Sbjct: 163 KRFFDMVDKNKDGKLNLKELTELVK---YNQTVAEIRE 197 >SB_27812| Best HMM Match : efhand (HMM E-Value=1.7e-07) Length = 78 Score = 25.4 bits (53), Expect = 6.7 Identities = 9/34 (26%), Positives = 19/34 (55%) Query: 9 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMR 42 ++++ + + F +DK+GD IT+ E +R Sbjct: 5 VSDQTMTRIPQEFKFYDKNGDLKITSDEFNHALR 38 >SB_39543| Best HMM Match : efhand (HMM E-Value=0.00063) Length = 54 Score = 25.0 bits (52), Expect = 8.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Query: 16 EFKEAFSLFDKDGDGTITTKEL 37 + K AFS++D DG+G I+ E+ Sbjct: 28 KLKWAFSMYDLDGNGYISRGEM 49 >SB_20477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 25.0 bits (52), Expect = 8.8 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 7/45 (15%) Query: 24 FDKDGDGTITTKELGTVMRSLG-------QNPTEAELQDMINEVD 61 FDKD G + +E + +RSLG + T+ E + +++ VD Sbjct: 3 FDKDKTGYLDHQEFKSCLRSLGYDLPVVEEGETDPEFETILSRVD 47 >SB_14048| Best HMM Match : CBF (HMM E-Value=9.6e-17) Length = 573 Score = 25.0 bits (52), Expect = 8.8 Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Query: 1 MVVMAADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAE--LQDMIN 58 +++ + L + + AEF +F D I K LG++ L + P + + L+ ++N Sbjct: 186 LILWHFEDLLKARYAEFVSSFERLLGDSLPEIRNKALGSIYDLLSERPEQEQFLLRLLVN 245 Query: 59 EV 60 +V Sbjct: 246 KV 247 >SB_43892| Best HMM Match : efhand (HMM E-Value=2.3e-11) Length = 353 Score = 25.0 bits (52), Expect = 8.8 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Query: 15 AEFKEAFSLFDKDGDGTITTKE--LGTVMRSLGQNPTEA 51 AE +E F+L+D+D G I +E +G + + N EA Sbjct: 309 AEVEELFNLYDRDESGFIDFREYLIGMALIAKPANNDEA 347 >SB_36462| Best HMM Match : efhand (HMM E-Value=5.8e-09) Length = 402 Score = 25.0 bits (52), Expect = 8.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Query: 22 SLFDKDGDGTITTKELGTVMRSLG 45 S FD+D GTI EL T + G Sbjct: 189 SSFDRDRSGTIDAGELNTAFSTFG 212 >SB_25627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 25.0 bits (52), Expect = 8.8 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 7/45 (15%) Query: 24 FDKDGDGTITTKELGTVMRSLG-------QNPTEAELQDMINEVD 61 FDKD G + +E + +RSLG + T+ E + +++ VD Sbjct: 3 FDKDKTGYLDHQEFKSCLRSLGYDLPVVEEGETDPEFETILSRVD 47 >SB_20575| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 1106 Score = 25.0 bits (52), Expect = 8.8 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKE---LGTVMRSLGQ 46 E+ + ++ A SLF K GD + K +G V RS G+ Sbjct: 332 EDALNNYQHALSLFQKTGDESCQAKAYLGMGKVHRSHGK 370 >SB_11617| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 318 Score = 25.0 bits (52), Expect = 8.8 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Query: 11 EEQIAEFKEAFSLFDKDGDGTITTKE---LGTVMRSLGQ 46 E+ + ++ A SLF K GD + K +G V RS G+ Sbjct: 212 EDTLNNYQHALSLFQKTGDESCQAKAYLGMGKVHRSHGK 250 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.314 0.130 0.357 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,107,284 Number of Sequences: 59808 Number of extensions: 65078 Number of successful extensions: 386 Number of sequences better than 10.0: 98 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 17 Number of HSP's that attempted gapping in prelim test: 225 Number of HSP's gapped (non-prelim): 184 length of query: 72 length of database: 16,821,457 effective HSP length: 50 effective length of query: 22 effective length of database: 13,831,057 effective search space: 304283254 effective search space used: 304283254 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -