Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001317-TA|BGIBMGA001317-PA|undefined
         (285 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ457831-1|CAD29886.1|  249|Tribolium castaneum helix-loop-helix...    21   7.9  

>AJ457831-1|CAD29886.1|  249|Tribolium castaneum helix-loop-helix
          transcription factor protein.
          Length = 249

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 11/34 (32%), Positives = 15/34 (44%)

Query: 64 TGNINTPVRSTPYSDTKSQEEDVQGQSNVTVRKR 97
          TG  NTPV+      T +Q E       V+  +R
Sbjct: 3  TGTNNTPVQPNAIPTTNNQIEMAAATKRVSDNRR 36


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.317    0.132    0.392 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 50,429
Number of Sequences: 317
Number of extensions: 1755
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 1
length of query: 285
length of database: 114,650
effective HSP length: 56
effective length of query: 229
effective length of database: 96,898
effective search space: 22189642
effective search space used: 22189642
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 43 (21.4 bits)