BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001317-TA|BGIBMGA001317-PA|undefined (285 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 23 3.1 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 3.1 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 22 7.1 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 23.0 bits (47), Expect = 3.1 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 173 TALNTTIKKIVVTEFKNVLDKIDGFRDSLEFMSTKYEEMKSKFESETSTITELKCD 228 T N+ I K ++ K+ G ++ M T EE+KSK + L+CD Sbjct: 13 TGANSGIGKCLIECLVGKGMKVIGIAPQVDKMKTLVEELKSK----PGKLVPLQCD 64 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/24 (33%), Positives = 17/24 (70%) Query: 167 LQQEISTALNTTIKKIVVTEFKNV 190 ++Q++ +L+T KKI ++ +NV Sbjct: 249 MRQDLGASLDTQFKKIYMSRHENV 272 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 230 ERLKTTIRDLTARLNAPLRRI 250 E++ TTI T +N P +R+ Sbjct: 79 EKVSTTIVPTTQEINKPFKRL 99 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.132 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,814 Number of Sequences: 429 Number of extensions: 2516 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 285 length of database: 140,377 effective HSP length: 57 effective length of query: 228 effective length of database: 115,924 effective search space: 26430672 effective search space used: 26430672 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -