GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001314-TA|BGIBMGA001314-PA|undefined
         (188 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY146749-1|AAO12064.1|  336|Anopheles gambiae odorant-binding pr...    23   4.4  

>AY146749-1|AAO12064.1|  336|Anopheles gambiae odorant-binding
           protein AgamOBP38 protein.
          Length = 336

 Score = 23.4 bits (48), Expect = 4.4
 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 1/38 (2%)

Query: 12  EYPAPPPSKCAKFLYYTWKLCSVVFSHFVMISLVVAYC 49
           E PAPP   CA   Y++++  S      +     VA C
Sbjct: 113 ELPAPPADSCAG-AYWSFRCYSDALGELIAHPAYVAPC 149


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.324    0.135    0.422 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 197,112
Number of Sequences: 2123
Number of extensions: 7340
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 11
Number of HSP's gapped (non-prelim): 1
length of query: 188
length of database: 516,269
effective HSP length: 60
effective length of query: 128
effective length of database: 388,889
effective search space: 49777792
effective search space used: 49777792
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 46 (22.6 bits)