BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001313-TA|BGIBMGA001313-PA|IPR005829|Sugar transporter superfamily, IPR007114|Major facilitator superfamily, IPR011701|Major facilitator superfamily MFS_1 (549 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 27 0.34 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 5.5 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 23 5.5 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 27.1 bits (57), Expect = 0.34 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 98 VPLTQPCSADTSFSQEALACDH 119 VPL Q C+A F +E L CD+ Sbjct: 448 VPLEQRCNAGLVFDEEKLWCDY 469 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.0 bits (47), Expect = 5.5 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Query: 454 TSELFPTRARHSLLAFCSMV---GRIGSIVAP 482 +S +FP R + + FC ++ G IG+++ P Sbjct: 59 SSSVFPNYIRTTSMVFCIIIMCLGVIGNVMVP 90 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 23.0 bits (47), Expect = 5.5 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Query: 454 TSELFPTRARHSLLAFCSMV---GRIGSIVAP 482 +S +FP R + + FC ++ G IG+++ P Sbjct: 59 SSSVFPNYIRTTSMVFCIIIMCLGVIGNVMVP 90 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.326 0.139 0.437 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,344 Number of Sequences: 317 Number of extensions: 4356 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 3 length of query: 549 length of database: 114,650 effective HSP length: 60 effective length of query: 489 effective length of database: 95,630 effective search space: 46763070 effective search space used: 46763070 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -