BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001312-TA|BGIBMGA001312-PA|undefined (338 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) 51 2e-06 SB_42965| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_44772| Best HMM Match : TPR_2 (HMM E-Value=0) 34 0.19 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 31 1.3 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 30 2.3 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 30 2.3 SB_28417| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_24812| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_9874| Best HMM Match : Sigma54_activat (HMM E-Value=0) 30 3.1 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_20703| Best HMM Match : TPR_1 (HMM E-Value=0) 29 4.1 SB_12498| Best HMM Match : TPR_1 (HMM E-Value=0) 29 4.1 SB_58067| Best HMM Match : TPR_2 (HMM E-Value=0) 29 4.1 SB_31762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_35388| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_5728| Best HMM Match : Band_41 (HMM E-Value=1e-26) 29 5.4 SB_45932| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_16818| Best HMM Match : Prefoldin (HMM E-Value=0.00051) 29 7.1 SB_49628| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) 29 7.1 SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_6118| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_55186| Best HMM Match : TPR_2 (HMM E-Value=0.91) 28 9.4 SB_24709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_14077| Best HMM Match : TPR_1 (HMM E-Value=0) 28 9.4 SB_6794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_29572| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 SB_28629| Best HMM Match : FCH (HMM E-Value=5.2e-06) 28 9.4 SB_15843| Best HMM Match : VWA (HMM E-Value=4.1e-35) 28 9.4 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) Length = 1134 Score = 50.8 bits (116), Expect = 2e-06 Identities = 41/146 (28%), Positives = 67/146 (45%), Gaps = 4/146 (2%) Query: 13 ETEIDKSREEANWKKAVELAQQLKSRSPQH---ESLAHFLIGEGKLEAYLDEWPPIKENI 69 E EI+++R E W+ +L +QL +R+ Q +SL L+ E LE Y + ++ Sbjct: 11 ENEIERARVEGRWESLSKLVEQLCTRTTQESQIDSLKILLLAEADLETYSRDHSLDVNDL 70 Query: 70 ERAQRELSEARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLAELNTL 129 A+ L L E KK + +A LLL K + G + +++ A + L Sbjct: 71 RAARSALEPVVTKLNNVIQER-KKDERSQEAMLLLCKAYFIQGEFQSSVQCCNEAGADDL 129 Query: 130 TEKELPVRSLRIVAESYAIKGFCLEQ 155 R R+VAE++A K LE+ Sbjct: 130 VIDMHFKRKSRLVAEAFAYKAMALEE 155 Score = 32.7 bits (71), Expect = 0.44 Identities = 18/53 (33%), Positives = 26/53 (49%) Query: 201 PWKPKKYAALNQFVPRNXXXXXXXXXXXXXAMAARDGVLSQSAEFAAARDHSL 253 P KP YA+ + F+PR+ +M RD VLS + AAAR ++ Sbjct: 307 PLKPLVYASDSLFIPRDEIEEALLLLLLEDSMVLRDAVLSVAPAKAAARSRTV 359 >SB_42965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 37.5 bits (83), Expect = 0.015 Identities = 37/108 (34%), Positives = 50/108 (46%), Gaps = 22/108 (20%) Query: 21 EEA--NWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKENIERAQRELSE 78 EEA ++K+A+ L Q K+ Q + AH LIG N Q + E Sbjct: 463 EEAIGHYKEALRLYQ--KTSDDQGQGKAHLLIG----------------NTHNQQGKYEE 504 Query: 79 ARGYLTLATDEAGKKAGVAL--DAQLLLGKLNYACGSYDEALKHYKLA 124 ARGY A K + V +A L +GK +Y G Y+EA+ HYK A Sbjct: 505 ARGYYKEALRLYQKTSDVQGQGEAHLRIGKTHYQQGKYEEAIGHYKEA 552 Score = 33.5 bits (73), Expect = 0.25 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 18/106 (16%) Query: 21 EEA--NWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKENIERAQRELSE 78 EEA ++K+A+ L Q K+ Q + AH LIG + + E A E Sbjct: 663 EEARGHYKEALRLYQ--KTSDDQGQGEAHLLIGNTHYQ---------QGKYEEAIGNYKE 711 Query: 79 ARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 A +D+ G+ +A LL+GK +Y Y+EA+ HYK A Sbjct: 712 ALRLYQKTSDDQGQG-----EAHLLIGKTHYQQCKYEEAIGHYKEA 752 Score = 31.9 bits (69), Expect = 0.76 Identities = 14/25 (56%), Positives = 17/25 (68%) Query: 100 AQLLLGKLNYACGSYDEALKHYKLA 124 A LL+GK +Y G Y+EA HYK A Sbjct: 408 ANLLIGKTHYQQGKYEEARGHYKEA 432 Score = 31.1 bits (67), Expect = 1.3 Identities = 34/106 (32%), Positives = 48/106 (45%), Gaps = 18/106 (16%) Query: 21 EEA--NWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKENIERAQRELSE 78 EEA ++K+A+ L Q KS Q + AH LIG D+ + E A+ E Sbjct: 583 EEARGHYKEALRLYQ--KSSDDQWQGKAHILIGNTH-----DQ----QGKYEEARGHYKE 631 Query: 79 ARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 A +D+ G+ A LL+G + G Y+EA HYK A Sbjct: 632 ALRLYQKTSDDQGQGK-----AHLLIGNTHNQQGKYEEARGHYKEA 672 Score = 29.9 bits (64), Expect = 3.1 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 5/74 (6%) Query: 51 GEGKLEAYLDEWPPIKENIERAQRELSEARGYLTLATDEAGKKAGVALDAQLLLGKLNYA 110 G+GK + + + E A+ EA ++D+ G+ A L +G ++ Sbjct: 404 GQGKANLLIGKTHYQQGKYEEARGHYKEALRLYQKSSDDQGQGK-----AHLQIGNTHHQ 458 Query: 111 CGSYDEALKHYKLA 124 G Y+EA+ HYK A Sbjct: 459 QGKYEEAIGHYKEA 472 >SB_44772| Best HMM Match : TPR_2 (HMM E-Value=0) Length = 845 Score = 33.9 bits (74), Expect = 0.19 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 16/99 (16%) Query: 26 KKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKENIERAQRELSEARGYLTL 85 K+A+ L Q K+ Q + AH LIG+ + + E A EA Sbjct: 375 KEALRLYQ--KTSDDQGQGKAHLLIGDIHYQ---------QGKYEEAIGHYKEALRLYQK 423 Query: 86 ATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 +D+ G+ +A LL+G +Y G Y+EA+ HYK A Sbjct: 424 TSDDQGQG-----EAHLLIGNTHYQQGKYEEAIGHYKEA 457 Score = 33.9 bits (74), Expect = 0.19 Identities = 34/116 (29%), Positives = 52/116 (44%), Gaps = 18/116 (15%) Query: 11 GFETEIDKSREEA--NWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKEN 68 G + EEA ++K+A+ L Q K+ Q + AH LIG+ + + Sbjct: 558 GITHNLQGKYEEAIGHYKEALRLYQ--KTSDDQGQGKAHLLIGDIHYQ---------QGK 606 Query: 69 IERAQRELSEARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 E A EA +D+ G+ +A LL+GK + G Y+EA+ HYK A Sbjct: 607 YEEAIGHYKEALRLYQKTSDDQGQG-----EAHLLIGKTHNFQGKYEEAIGHYKEA 657 Score = 33.9 bits (74), Expect = 0.19 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 18/106 (16%) Query: 21 EEA--NWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKENIERAQRELSE 78 EEA ++K+A+ L Q K+ Q + AH LIGE + + E A+ E Sbjct: 648 EEAIGHYKEALRLYQ--KTSDDQGQGKAHLLIGETHYQ---------QGKYEEARGHSKE 696 Query: 79 ARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 A +D+ G+ A LL+G +Y G Y+EA+ H K A Sbjct: 697 ALRLYQKTSDDQGQGK-----AHLLIGNTHYQQGKYEEAIGHSKEA 737 Score = 33.5 bits (73), Expect = 0.25 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 5/74 (6%) Query: 51 GEGKLEAYLDEWPPIKENIERAQRELSEARGYLTLATDEAGKKAGVALDAQLLLGKLNYA 110 G+GK ++ ++ E A EA +D+ G+ +A LL+GK +Y Sbjct: 269 GQGKAHLFIGNAHNLQGKYEEAIGHYKEALRLYQKTSDDQGQG-----EAHLLIGKTHYQ 323 Query: 111 CGSYDEALKHYKLA 124 G Y+EA H K A Sbjct: 324 QGKYEEARGHSKEA 337 Score = 33.1 bits (72), Expect = 0.33 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 16/99 (16%) Query: 26 KKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKENIERAQRELSEARGYLTL 85 K+A+ L Q K+ Q + AH LIG+ + + E A EA Sbjct: 335 KEALRLYQ--KTSDDQGQGKAHLLIGDIHYQ---------QGKYEEAIGHSKEALRLYQK 383 Query: 86 ATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 +D+ G+ A LL+G ++Y G Y+EA+ HYK A Sbjct: 384 TSDDQGQGK-----AHLLIGDIHYQQGKYEEAIGHYKEA 417 Score = 33.1 bits (72), Expect = 0.33 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 18/106 (16%) Query: 21 EEA--NWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKENIERAQRELSE 78 EEA ++K+A+ L Q K+ Q + AH LIG + + E A E Sbjct: 408 EEAIGHYKEALRLYQ--KTSDDQGQGEAHLLIGNTHYQ---------QGKYEEAIGHYKE 456 Query: 79 ARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 A +D+ G+ +A LL+G +Y G Y+EA+ H+K A Sbjct: 457 ALRLYQKTSDDQGQG-----EAHLLIGDTHYQQGKYEEAIGHFKEA 497 Score = 31.9 bits (69), Expect = 0.76 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 16/99 (16%) Query: 26 KKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKENIERAQRELSEARGYLTL 85 K+A+ L Q K+ Q + AH LIG + + E A+ EA Sbjct: 735 KEALRLYQ--KTSDDQGQGKAHLLIGNTHYQ---------QGKYEEARGHSKEALRLYQK 783 Query: 86 ATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 +D+ G+ +A LL+GK +Y G Y+EA H K A Sbjct: 784 TSDDQGQG-----EAHLLIGKTHYQQGKYEEARGHSKEA 817 Score = 30.3 bits (65), Expect = 2.3 Identities = 32/118 (27%), Positives = 50/118 (42%), Gaps = 9/118 (7%) Query: 7 NAVRGFETEIDKSREEANWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIK 66 N + G++ + R + + ++ Q S A L+G G+ Y D Sbjct: 152 NLLIGYKHYQQELRSQHSLPSNGQVRQTHNGESGDERDQAEELMGRGR--KYYD-----M 204 Query: 67 ENIERAQRELSEA-RGYLTLATDEAGKKAGVAL-DAQLLLGKLNYACGSYDEALKHYK 122 +N E A EA R Y + D+ KA + + +A L GK A G Y EAL+ Y+ Sbjct: 205 DNYEEAIEHYKEALRLYQKTSDDQRQGKAHLLIGNAHNLQGKYEEAIGHYKEALRLYQ 262 Score = 30.3 bits (65), Expect = 2.3 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 18/106 (16%) Query: 21 EEA--NWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKENIERAQRELSE 78 EEA ++K+A+ L Q K+ Q + AH LIG + + E A+ E Sbjct: 488 EEAIGHFKEALRLYQ--KTSDDQGQGEAHLLIGNTHYQ---------QGKYEEARGHSKE 536 Query: 79 ARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 A +D+ G +A LL+G + G Y+EA+ HYK A Sbjct: 537 ALTLYQKTSDDQGHG-----EAHLLIGITHNLQGKYEEAIGHYKEA 577 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/78 (25%), Positives = 35/78 (44%) Query: 17 DKSREEANWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKENIERAQREL 76 +K R E K+ E + + ++ E L + E + + L+ KE +ER QRE Sbjct: 252 EKRRAEEEAKRKAEEEKAAREKAEMEEKLRRLKLQEKEEKRKLEAEKKEKERVEREQREE 311 Query: 77 SEARGYLTLATDEAGKKA 94 + A ++A +KA Sbjct: 312 RRKQEEKRRAEEQARRKA 329 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 30.3 bits (65), Expect = 2.3 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 2/85 (2%) Query: 123 LAELNTLTEKELPVRSLRIVAESYAIKGFCLEQNAVPS-STSRYKQAEREAE-MVYKPPV 180 L E + + EKELPV + ++V E K +++ V + K EREA+ + KP + Sbjct: 5162 LEEKHLVEEKELPVSAEKVVEEKPLEKPITRKEDKVEEVKPKKEKPMEREAQHLEEKPLL 5221 Query: 181 AVAPAQGTLTRRREDHVSEGPWKPK 205 + + E+ E P+ PK Sbjct: 5222 KEKELPVSAEKAIEEKPLEKPFTPK 5246 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/49 (30%), Positives = 26/49 (53%) Query: 15 EIDKSREEANWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWP 63 E + RE KKA + A++L + +P E L+H + E + + E+P Sbjct: 976 ERQEKRERKAKKKAEKAAEKLAAATPSEEPLSHHPVAEQRSAYHRPEFP 1024 >SB_28417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Query: 14 TEIDKSREEANWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYL 59 T ++KS + W + LA+ L+ RSP H ++A +GK YL Sbjct: 33 TPLEKSLVDLTWIRT--LARLLEKRSPYHRAIAPLSRYQGKTALYL 76 >SB_24812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1384 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 19 SREEANWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKENIERAQRELSE 78 +RE+ WK V++ Q+ ++ ++ S L+ + KL E KE E + EL Sbjct: 355 TREKEEWKGQVQVLQERLNKETEYRSEVERLLDQEKLNVTNTEMVKRKET-EELKSELEN 413 Query: 79 AR 80 AR Sbjct: 414 AR 415 >SB_9874| Best HMM Match : Sigma54_activat (HMM E-Value=0) Length = 314 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/30 (33%), Positives = 21/30 (70%) Query: 111 CGSYDEALKHYKLAELNTLTEKELPVRSLR 140 CG++D +K + L ELN + ++ L ++S++ Sbjct: 119 CGAFDYVIKPFDLDELNLIVQRALQLQSMK 148 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 29.9 bits (64), Expect = 3.1 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 9/86 (10%) Query: 15 EIDKSREEANWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEW-PPIKENIERAQ 73 E++KS + N K A + ++ LA L KLE EW ++ N+ER + Sbjct: 787 ELEKSLNDKNLKLAASEEKVIE--------LAEELAKRLKLEQETAEWIEGVEGNMERTE 838 Query: 74 RELSEARGYLTLATDEAGKKAGVALD 99 R+LS A+ L E + G LD Sbjct: 839 RDLSSAKSALLEKAKELEDEKGRILD 864 >SB_20703| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 693 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Query: 68 NIERAQRELSEARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 N E A + +A + ++T K+AGV L+ +G + + G+Y+EA+K+++ A Sbjct: 467 NYEEAMKYYQQAL-QVYISTGNESKQAGVRLN----IGGVQQSLGNYEEAMKYFQQA 518 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 5/57 (8%) Query: 68 NIERAQRELSEARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 N E A + +A + ++T K+AGV L+ +G + G+Y+EA+K+++ A Sbjct: 147 NYEEAMKYCQQAL-QVYISTGNESKQAGVRLN----IGGVQQRLGNYEEAMKYFQQA 198 Score = 28.3 bits (60), Expect = 9.4 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 5/57 (8%) Query: 68 NIERAQRELSEARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 N E A + +A +E+ K+AGV L+ +G + G+Y+EA+K+Y+ A Sbjct: 307 NYEEAMKYYQQALQVFERTGNES-KQAGVRLN----IGGVQQRLGNYEEAMKYYQQA 358 >SB_12498| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 495 Score = 29.5 bits (63), Expect = 4.1 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 8/84 (9%) Query: 65 IKENIERAQRELS---EARGYLTLAT---DEAGKKAGVALDAQLLLGKLNYACGSYDEAL 118 +++NI Q+ L EA Y A + G ++G A D + +G + G+Y+EA+ Sbjct: 143 VRQNIGVVQKSLGNYEEAMKYYQQALQVFERTGNESGQA-DVRHNIGVVQQCLGNYEEAM 201 Query: 119 KHYKLA-ELNTLTEKELPVRSLRI 141 K+Y+ A ++ T E S+R+ Sbjct: 202 KYYQQALQVYERTGNESKQASVRL 225 >SB_58067| Best HMM Match : TPR_2 (HMM E-Value=0) Length = 593 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 99 DAQLLLGKLNYACGSYDEALKHY 121 D L +G +Y C +Y +A+KHY Sbjct: 372 DVHLNIGNTHYECKNYKDAMKHY 394 >SB_31762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1038 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 99 DAQLLLGKLNYACGSYDEALKHY 121 D L +G +Y C +Y +A+KHY Sbjct: 671 DVHLNIGNTHYECKNYKDAMKHY 693 >SB_35388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 29.1 bits (62), Expect = 5.4 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 14 TEIDKSREEANWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYL 59 T + KS + W + LA+ L+ RSP H ++A EGK YL Sbjct: 21 TPLKKSLVDLTWIRT--LARLLEKRSPYHGAIAPLSRYEGKTTPYL 64 >SB_5728| Best HMM Match : Band_41 (HMM E-Value=1e-26) Length = 906 Score = 29.1 bits (62), Expect = 5.4 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query: 24 NWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPIKEN 68 NW+ EL L+ S H++ F+ +LE Y DE+ P K+N Sbjct: 730 NWQMIKELHTNLRGLSA-HDAEMEFIRLVQQLEGYGDEYYPAKDN 773 >SB_45932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 29.1 bits (62), Expect = 5.4 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Query: 14 TEIDKSREEANWKKAVELAQQLKSRSPQHESLAHF 48 T + KS + W + LA+ L+ RSP H ++AHF Sbjct: 45 TPLKKSLVDLTWIRT--LARLLEKRSPYHGAIAHF 77 >SB_16818| Best HMM Match : Prefoldin (HMM E-Value=0.00051) Length = 162 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/21 (52%), Positives = 16/21 (76%) Query: 113 SYDEALKHYKLAELNTLTEKE 133 S+DE L+ YK E+N LT+K+ Sbjct: 48 SFDEQLRKYKFMEINLLTKKK 68 >SB_49628| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) Length = 312 Score = 28.7 bits (61), Expect = 7.1 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 11/94 (11%) Query: 89 EAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLAELNTLTEKELP--------VRSLR 140 E KK G+ L A LG + + G Y+ ++ N ELP V L Sbjct: 130 EMEKKLGIKLVAVDALGNVLWDSGKYERGYTEIRIPCHNNHAWAELPTEPPAIASVHGLD 189 Query: 141 IVAESYAIKGFCLEQNAVPSSTSRYKQAEREAEM 174 AES ++ FC + A P +TS +A REA++ Sbjct: 190 FEAES-ELRSFC-QGEAAPRATSAATKA-REAKV 220 >SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 28.7 bits (61), Expect = 7.1 Identities = 20/86 (23%), Positives = 34/86 (39%) Query: 163 SRYKQAEREAEMVYKPPVAVAPAQGTLTRRREDHVSEGPWKPKKYAALNQFVPRNXXXXX 222 +R +A +EA V + PVA P++ R R D + G + +A N Sbjct: 791 NRINRANKEALRVVRSPVAPGPSEPQGLRARADDAAAGTARAGTPSAHTPVPESNSAWSA 850 Query: 223 XXXXXXXXAMAARDGVLSQSAEFAAA 248 + + G+ ++ E AAA Sbjct: 851 SSVIGVAGLLVSLIGLYTRRQELAAA 876 >SB_6118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Query: 14 TEIDKSREEANWKKAVELAQQLKSRSPQHESLAHF 48 T + KS + W + LA+ L+ RSP H ++AHF Sbjct: 30 TPLKKSLVDFTWIRT--LARLLEKRSPYHGAIAHF 62 >SB_55186| Best HMM Match : TPR_2 (HMM E-Value=0.91) Length = 571 Score = 28.3 bits (60), Expect = 9.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Query: 14 TEIDKSREEANWKKAVELAQQLKSRSPQHESLAH 47 +E+D+ +E N+ KA ++A ++ SP E H Sbjct: 80 SELDRLGKEGNYSKAQKIANKILQESPADEDAFH 113 >SB_24709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 540 Score = 28.3 bits (60), Expect = 9.4 Identities = 20/86 (23%), Positives = 34/86 (39%) Query: 163 SRYKQAEREAEMVYKPPVAVAPAQGTLTRRREDHVSEGPWKPKKYAALNQFVPRNXXXXX 222 +R +A +EA V + PVA P++ R R D + G + +A N Sbjct: 209 NRINRANKEALRVVQSPVAPGPSEPQGLRARADDAAAGTARADTPSAHTPVPESNFAWSA 268 Query: 223 XXXXXXXXAMAARDGVLSQSAEFAAA 248 + + G+ ++ E AAA Sbjct: 269 SSVIGVAGLLVSLIGLYTRRQELAAA 294 >SB_14077| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 357 Score = 28.3 bits (60), Expect = 9.4 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 5/57 (8%) Query: 68 NIERAQRELSEARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKHYKLA 124 N E A + +A +E+ K+AGV L+ +G + G+Y+EA+K+Y+ A Sbjct: 187 NYEEAMKYYQQALQVFERTGNES-KQAGVRLN----IGGVQQRLGNYEEAMKYYQQA 238 >SB_6794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1042 Score = 28.3 bits (60), Expect = 9.4 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 67 ENIERAQRELSEARGYLTLATDEAGKKAGVALDAQLLLGKLNYACGSYDEALKH 120 ++I + Q ++ A+ L+LA + K+ + A LG Y+ +D++LKH Sbjct: 193 DSIGKPQEAINHAKTALSLAKEHKLKR--IEGQAHACLGDAYYSIAKFDDSLKH 244 >SB_29572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 617 Score = 28.3 bits (60), Expect = 9.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Query: 48 FLIGEGKLEAYLDEWPPIKENIERAQRELSE 78 F + + L LDE+P IKE IE+ +E E Sbjct: 473 FCLAKNDLMEVLDEYPNIKEKIEKIAKEKLE 503 >SB_28629| Best HMM Match : FCH (HMM E-Value=5.2e-06) Length = 317 Score = 28.3 bits (60), Expect = 9.4 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 2/71 (2%) Query: 66 KENIERAQRELSEARGYLTLATDEAGKKAGVALDAQLLLGKLNY--ACGSYDEALKHYKL 123 K + R ++ + ++ A +A A Q+L K Y AC + D+A K Y Sbjct: 58 KRTVRRVDDGAKLCDDFMKMVSERAEIEALYAAKLQVLKSKKAYYAACRARDQAEKLYNS 117 Query: 124 AELNTLTEKEL 134 ++ NT+ E ++ Sbjct: 118 SDPNTIKEDQI 128 >SB_15843| Best HMM Match : VWA (HMM E-Value=4.1e-35) Length = 1686 Score = 28.3 bits (60), Expect = 9.4 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 4/83 (4%) Query: 6 KNAVRGFETEIDKSREEANWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEWPPI 65 KN GF+ E++ + + + AV L + K + +S + I E PPI Sbjct: 1482 KNCTVGFKPEVEHRKYVYDLRIAVLLKHRKKHKKFTDDSSEYPNIRRSSDI----EVPPI 1537 Query: 66 KENIERAQRELSEARGYLTLATD 88 N E A++ L R YL + ++ Sbjct: 1538 TRNFEDAEQRLRSVRNYLGIMSN 1560 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 28.3 bits (60), Expect = 9.4 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 4/67 (5%) Query: 3 SKSKNAVRGFETEIDKSREEANWKKAVELAQQLKSRSPQHESLAHFLIGEGKLEAYLDEW 62 SKSKN G TE+ K EE N + E+ ++++ +E + L KL L+E Sbjct: 1923 SKSKNLENGKATEMVKKNEEKN-NEIEEMREKMRK---ANEEIEKILSKNSKLSDILNEL 1978 Query: 63 PPIKENI 69 ENI Sbjct: 1979 NSGIENI 1985 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.313 0.128 0.369 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,158,477 Number of Sequences: 59808 Number of extensions: 274150 Number of successful extensions: 816 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 18 Number of HSP's that attempted gapping in prelim test: 735 Number of HSP's gapped (non-prelim): 95 length of query: 338 length of database: 16,821,457 effective HSP length: 83 effective length of query: 255 effective length of database: 11,857,393 effective search space: 3023635215 effective search space used: 3023635215 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -