BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001311-TA|BGIBMGA001311-PA|undefined (85 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY047518-1|AAK77250.1| 535|Drosophila melanogaster GH02452p pro... 56 6e-09 AE014296-1822|AAN11917.1| 535|Drosophila melanogaster CG32063-P... 56 6e-09 AE014296-1821|AAN11916.1| 535|Drosophila melanogaster CG32063-P... 56 6e-09 BT022093-1|AAY33509.1| 527|Drosophila melanogaster AT20029p pro... 53 4e-08 AE013599-1763|AAF58338.1| 527|Drosophila melanogaster CG13340-P... 53 4e-08 AY047564-1|AAK77296.1| 534|Drosophila melanogaster GH07689p pro... 52 9e-08 AE013599-2289|AAF57992.1| 534|Drosophila melanogaster CG4439-PA... 52 9e-08 DQ062764-1|AAY56637.1| 524|Drosophila melanogaster unknown prot... 52 1e-07 BT003650-1|AAO39654.1| 524|Drosophila melanogaster AT09752p pro... 52 1e-07 AY061822-1|AAL27633.1| 524|Drosophila melanogaster GH10924p pro... 52 1e-07 AE014296-1823|AAN11918.1| 524|Drosophila melanogaster CG32064-P... 52 1e-07 AY089217-1|AAL89955.1| 549|Drosophila melanogaster AT01812p pro... 50 5e-07 AE013599-1754|AAF58347.1| 549|Drosophila melanogaster CG18369-P... 50 5e-07 AY060684-1|AAL28232.1| 526|Drosophila melanogaster GH12543p pro... 43 6e-05 AE013599-2295|AAF57988.1| 526|Drosophila melanogaster CG4750-PA... 43 6e-05 AY118273-1|AAM48302.1| 555|Drosophila melanogaster AT03383p pro... 34 0.020 AY058360-1|AAL13589.1| 555|Drosophila melanogaster GH13022p pro... 34 0.020 AE014296-1488|AAF50390.2| 555|Drosophila melanogaster CG6372-PA... 34 0.020 AE014296-1489|AAF50389.1| 552|Drosophila melanogaster CG32351-P... 33 0.035 BT001364-1|AAN71119.1| 124|Drosophila melanogaster AT30014p pro... 26 5.4 AY113267-1|AAM29272.1| 396|Drosophila melanogaster AT16233p pro... 26 5.4 AY089489-1|AAL90227.1| 396|Drosophila melanogaster AT31848p pro... 26 5.4 AY089480-1|AAL90218.1| 180|Drosophila melanogaster AT29351p pro... 26 5.4 AE014297-1459|AAF54757.2| 396|Drosophila melanogaster CG3809-PA... 26 5.4 U70979-1|AAD03390.1| 226|Drosophila melanogaster saliva protein. 26 7.1 >AY047518-1|AAK77250.1| 535|Drosophila melanogaster GH02452p protein. Length = 535 Score = 56.0 bits (129), Expect = 6e-09 Identities = 29/61 (47%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 23 YSTTVLRRACPQSFVCCS-WLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRL 81 Y+++ L A V CS W H+DT G G L+ PYL+A RMTGRP RTLV L ++ Sbjct: 469 YASSCLAAAVLHELVPCSDWAHLDTYGTGLLSTYGLIPYLTAGRMTGRPTRTLVQFLYQI 528 Query: 82 A 82 A Sbjct: 529 A 529 >AE014296-1822|AAN11917.1| 535|Drosophila melanogaster CG32063-PB, isoform B protein. Length = 535 Score = 56.0 bits (129), Expect = 6e-09 Identities = 29/61 (47%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 23 YSTTVLRRACPQSFVCCS-WLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRL 81 Y+++ L A V CS W H+DT G G L+ PYL+A RMTGRP RTLV L ++ Sbjct: 469 YASSCLAAAVLHELVPCSDWAHLDTYGTGLLSTYGLIPYLTAGRMTGRPTRTLVQFLYQI 528 Query: 82 A 82 A Sbjct: 529 A 529 >AE014296-1821|AAN11916.1| 535|Drosophila melanogaster CG32063-PA, isoform A protein. Length = 535 Score = 56.0 bits (129), Expect = 6e-09 Identities = 29/61 (47%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 23 YSTTVLRRACPQSFVCCS-WLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRL 81 Y+++ L A V CS W H+DT G G L+ PYL+A RMTGRP RTLV L ++ Sbjct: 469 YASSCLAAAVLHELVPCSDWAHLDTYGTGLLSTYGLIPYLTAGRMTGRPTRTLVQFLYQI 528 Query: 82 A 82 A Sbjct: 529 A 529 >BT022093-1|AAY33509.1| 527|Drosophila melanogaster AT20029p protein. Length = 527 Score = 53.2 bits (122), Expect = 4e-08 Identities = 22/45 (48%), Positives = 29/45 (64%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLA 82 C W H+DT G G L+ PYL+ +RMTGRP RTLV + ++A Sbjct: 478 CVDWAHLDTRGTGLLSKYGLVPYLTKKRMTGRPTRTLVQFVYQMA 522 >AE013599-1763|AAF58338.1| 527|Drosophila melanogaster CG13340-PA protein. Length = 527 Score = 53.2 bits (122), Expect = 4e-08 Identities = 22/45 (48%), Positives = 29/45 (64%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLA 82 C W H+DT G G L+ PYL+ +RMTGRP RTLV + ++A Sbjct: 478 CVDWAHLDTRGTGLLSKYGLVPYLTKKRMTGRPTRTLVQFVYQMA 522 >AY047564-1|AAK77296.1| 534|Drosophila melanogaster GH07689p protein. Length = 534 Score = 52.0 bits (119), Expect = 9e-08 Identities = 21/45 (46%), Positives = 28/45 (62%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLA 82 C W+H+DT G G LA PPYL MTGRP R+++ L ++A Sbjct: 488 CSDWVHLDTHGTGMLAKHGVPPYLLKDCMTGRPTRSIIQFLYQMA 532 >AE013599-2289|AAF57992.1| 534|Drosophila melanogaster CG4439-PA protein. Length = 534 Score = 52.0 bits (119), Expect = 9e-08 Identities = 21/45 (46%), Positives = 28/45 (62%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLA 82 C W+H+DT G G LA PPYL MTGRP R+++ L ++A Sbjct: 488 CSDWVHLDTHGTGMLAKHGVPPYLLKDCMTGRPTRSIIQFLYQMA 532 >DQ062764-1|AAY56637.1| 524|Drosophila melanogaster unknown protein. Length = 524 Score = 51.6 bits (118), Expect = 1e-07 Identities = 22/45 (48%), Positives = 27/45 (60%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLA 82 C W H+DT G G L PYL+A+ MTGRP RTL L ++A Sbjct: 474 CVDWAHLDTRGTGLLTKYGLVPYLTAKYMTGRPTRTLAQFLYQMA 518 >BT003650-1|AAO39654.1| 524|Drosophila melanogaster AT09752p protein. Length = 524 Score = 51.6 bits (118), Expect = 1e-07 Identities = 22/45 (48%), Positives = 27/45 (60%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLA 82 C W H+DT G G L PYL+A+ MTGRP RTL L ++A Sbjct: 474 CVDWAHLDTRGTGLLTKYGLVPYLTAKYMTGRPTRTLAQFLYQMA 518 >AY061822-1|AAL27633.1| 524|Drosophila melanogaster GH10924p protein. Length = 524 Score = 51.6 bits (118), Expect = 1e-07 Identities = 22/45 (48%), Positives = 27/45 (60%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLA 82 C W H+DT G G L PYL+A+ MTGRP RTL L ++A Sbjct: 474 CVDWAHLDTRGTGLLTKYGLVPYLTAKYMTGRPTRTLAQFLYQMA 518 >AE014296-1823|AAN11918.1| 524|Drosophila melanogaster CG32064-PA protein. Length = 524 Score = 51.6 bits (118), Expect = 1e-07 Identities = 22/45 (48%), Positives = 27/45 (60%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLA 82 C W H+DT G G L PYL+A+ MTGRP RTL L ++A Sbjct: 474 CVDWAHLDTRGTGLLTKYGLVPYLTAKYMTGRPTRTLAQFLYQMA 518 >AY089217-1|AAL89955.1| 549|Drosophila melanogaster AT01812p protein. Length = 549 Score = 49.6 bits (113), Expect = 5e-07 Identities = 21/45 (46%), Positives = 26/45 (57%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLA 82 C W H+D VG L + PYL RMTGRP RT+V L ++A Sbjct: 500 CADWAHIDIRNVGMLTRHNPLPYLLKDRMTGRPTRTIVQFLYQMA 544 >AE013599-1754|AAF58347.1| 549|Drosophila melanogaster CG18369-PA protein. Length = 549 Score = 49.6 bits (113), Expect = 5e-07 Identities = 21/45 (46%), Positives = 26/45 (57%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLA 82 C W H+D VG L + PYL RMTGRP RT+V L ++A Sbjct: 500 CADWAHIDIRNVGMLTRHNPLPYLLKDRMTGRPTRTIVQFLYQMA 544 >AY060684-1|AAL28232.1| 526|Drosophila melanogaster GH12543p protein. Length = 526 Score = 42.7 bits (96), Expect = 6e-05 Identities = 17/47 (36%), Positives = 25/47 (53%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLAAA 84 C W H+D G G + PYL MTGRP RT++ + ++A + Sbjct: 479 CAEWAHLDIRGTGMTTTINPRPYLLKDSMTGRPTRTVIQFMYQMACS 525 >AE013599-2295|AAF57988.1| 526|Drosophila melanogaster CG4750-PA protein. Length = 526 Score = 42.7 bits (96), Expect = 6e-05 Identities = 17/47 (36%), Positives = 25/47 (53%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALLQRLAAA 84 C W H+D G G + PYL MTGRP RT++ + ++A + Sbjct: 479 CAEWAHLDIRGTGMTTTINPRPYLLKDSMTGRPTRTVIQFMYQMACS 525 >AY118273-1|AAM48302.1| 555|Drosophila melanogaster AT03383p protein. Length = 555 Score = 34.3 bits (75), Expect = 0.020 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALL 78 C W+H+D T V + +G YL R M GRP RTL+ + Sbjct: 503 CGQWMHIDATNV-MVTNGIDFEYL-RRGMAGRPTRTLIEFI 541 >AY058360-1|AAL13589.1| 555|Drosophila melanogaster GH13022p protein. Length = 555 Score = 34.3 bits (75), Expect = 0.020 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALL 78 C W+H+D T V + +G YL R M GRP RTL+ + Sbjct: 503 CGQWMHIDATNV-MVTNGIDFEYL-RRGMAGRPTRTLIEFI 541 >AE014296-1488|AAF50390.2| 555|Drosophila melanogaster CG6372-PA protein. Length = 555 Score = 34.3 bits (75), Expect = 0.020 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALL 78 C W+H+D T V + +G YL R M GRP RTL+ + Sbjct: 503 CGQWMHIDATNV-MVTNGIDFEYL-RRGMAGRPTRTLIEFI 541 >AE014296-1489|AAF50389.1| 552|Drosophila melanogaster CG32351-PA protein. Length = 552 Score = 33.5 bits (73), Expect = 0.035 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Query: 38 CCSWLHVDTTGVGKLAHGSAPPYLSARRMTGRPARTLVALL 78 C W+H+D T V + G YL M GRP RTL+ + Sbjct: 500 CGQWMHIDATNV-MITRGDEFEYL-REGMAGRPTRTLIEFI 538 >BT001364-1|AAN71119.1| 124|Drosophila melanogaster AT30014p protein. Length = 124 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 11 RRFPLTPPKVQHYSTTVLRRACPQSFVCC 39 RR P+ PP QH+S V R + +SF C Sbjct: 17 RRTPIHPPAFQHFSGGVFRTSF-RSFCDC 44 >AY113267-1|AAM29272.1| 396|Drosophila melanogaster AT16233p protein. Length = 396 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 11 RRFPLTPPKVQHYSTTVLRRACPQSFVCC 39 RR P+ PP QH+S V R + +SF C Sbjct: 17 RRTPIHPPAFQHFSGGVFRTSF-RSFCDC 44 >AY089489-1|AAL90227.1| 396|Drosophila melanogaster AT31848p protein. Length = 396 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 11 RRFPLTPPKVQHYSTTVLRRACPQSFVCC 39 RR P+ PP QH+S V R + +SF C Sbjct: 17 RRTPIHPPAFQHFSGGVFRTSF-RSFCDC 44 >AY089480-1|AAL90218.1| 180|Drosophila melanogaster AT29351p protein. Length = 180 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 11 RRFPLTPPKVQHYSTTVLRRACPQSFVCC 39 RR P+ PP QH+S V R + +SF C Sbjct: 17 RRTPIHPPAFQHFSGGVFRTSF-RSFCDC 44 >AE014297-1459|AAF54757.2| 396|Drosophila melanogaster CG3809-PA protein. Length = 396 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 11 RRFPLTPPKVQHYSTTVLRRACPQSFVCC 39 RR P+ PP QH+S V R + +SF C Sbjct: 17 RRTPIHPPAFQHFSGGVFRTSF-RSFCDC 44 >U70979-1|AAD03390.1| 226|Drosophila melanogaster saliva protein. Length = 226 Score = 25.8 bits (54), Expect = 7.1 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Query: 22 HYSTTVLRRACPQSFVCCSWLHVDTTGVGKLAHGSA 57 +Y TV +RAC + F CS D +G G H SA Sbjct: 86 YYVFTVNKRACVKQFGVCS----DCSGGGHCLHQSA 117 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.327 0.136 0.439 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,457,816 Number of Sequences: 52641 Number of extensions: 158939 Number of successful extensions: 318 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 10 Number of HSP's that attempted gapping in prelim test: 299 Number of HSP's gapped (non-prelim): 25 length of query: 85 length of database: 24,830,863 effective HSP length: 65 effective length of query: 20 effective length of database: 21,409,198 effective search space: 428183960 effective search space used: 428183960 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -