BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001309-TA|BGIBMGA001309-PA|IPR003780|Cytochrome oxidase assembly (318 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1123 + 24474434-24474538,24474800-24474860,24475050-244754... 215 3e-56 >08_02_1123 + 24474434-24474538,24474800-24474860,24475050-24475477, 24475915-24476231,24476991-24477216,24477302-24477547, 24477635-24477745,24478051-24478182,24478297-24478325, 24478352-24478502 Length = 601 Score = 215 bits (526), Expect = 3e-56 Identities = 104/234 (44%), Positives = 141/234 (60%), Gaps = 1/234 (0%) Query: 1 MVTWRLLGEKMPTNEEEWQKEFEKYQQYPEFKYKNQNITFSDFKWIWYMEFAHRTWGRAI 60 M W+ G P ++EEW EFEKY+ PE+K N+ ++ DFK+I++ME+ HR WGRA+ Sbjct: 272 MTDWKFTGSLPPMSDEEWLLEFEKYKLSPEYKRVNKGMSLGDFKFIYWMEYGHRMWGRAL 331 Query: 61 GAAMFLPAAYFWYRGMLLPDMKIRVAVYCGLVAAQGLMGWYMVKSGLEDRFHGPSDVPRV 120 G +P AYF +G + + +R++ L A QGL+GW+MVKSGLE+ PRV Sbjct: 332 GFLFSVPFAYFIAKGYVTRQLGLRLSGLFALGAGQGLIGWWMVKSGLEEP-ASEYVQPRV 390 Query: 121 SQYRLAAHLSXXXXXXXXXXXXXXXXXRPFPAAATLQKIKELKSITGLAHAVKAMTFITA 180 S YRLA HL+ P P A ++ + I LA V A+ ITA Sbjct: 391 SPYRLATHLTSAFVIYCGILWTALSVVMPEPPAGSMNWVNSAAKIKKLAIPVSAVVGITA 450 Query: 181 VSGAFVAGLDAGLVYNSFPKMGDNWLPDDILAFSPTIKNFTENPTTVQFDHRVL 234 +SGAFVAG DAG YN+FPKMGD W+P+D+ A P I+NF EN +TVQ +HR+L Sbjct: 451 ISGAFVAGNDAGHAYNTFPKMGDTWIPEDVFAMEPFIRNFFENTSTVQLNHRIL 504 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.324 0.136 0.437 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,826,458 Number of Sequences: 37544 Number of extensions: 274968 Number of successful extensions: 785 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 782 Number of HSP's gapped (non-prelim): 1 length of query: 318 length of database: 14,793,348 effective HSP length: 82 effective length of query: 236 effective length of database: 11,714,740 effective search space: 2764678640 effective search space used: 2764678640 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.5 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -